Sequence:
download
CE33255sequence.fasta
>GLD-2, isoform c MPLSTGSIDSGFFGCTTNDSLKKGDIEDPQKTTPLSMTDEEETFSTSSSGFSQSSAPPLGDAILSSSNSTSSYLTLNSGA YPRKHRTRVRRSNRKLKRLPQNMSMRFESSSLFSNTLTESLETASCCVSVAGSSRSSLSSSSNSANASYDDMVIRLYFYF KSLLIAINHQKMICESIAYLVKDFDARWGNSGVRKKACDPKGCLAPIYTSSRNTDGGLDKKLVKPANFPMCWAVPQPAIF YQLMAIDVVEYIKFLERISPQLKTQQQSPGIPIQNEAEASAVMKAMRSFQFHNWPQMSHGSYYPMPYHLENQMRPMKSGD QLPLNQQNHNLSGFPAFVGKSSLVGSSLNTRNSSEADPEEMPRIMEKLDDEVTGADHDKTIDENRRRIHKSQEPRIGTEE KALNELPRKANRRNSSCSSISSVSESSSPSALDESTLTKILPTDNFRGGRGFASPSPPTSLLSEPLSRMDVLSEKIWDYH NKVSQTDEMLQRKLHLRDMLYTAISPVFPLSGLYVVGSSLNGFGNNSSDMDLCLMITNKDLDQKNDAVVVLNLILSTLQY EKFVESQKLILAKVPILRINFAAPFDDITVDLNANNSVAIRNTHLLCYYSSYDWRVRPLVSVVKEWAKRKGINDANKSSF TSYSLVLMVIHFLQCGPTKVLPNLQQSYPNRFSNKVDVRTLNVTMALEEVADDIDQSLSEKTTLGELLIGFLDYYANEFN YDRDAISIRQGRRVERAALAVRPKIHSNSEGDKETPPPSSSASTSSIHNGGTPGIPMHHSISNPHFWRSQWRCVCIEEPF TNSNTAHSIYDEMVFEAIKKAFREAHGELQHNHDLDKLMECEPIKASTTNTGAAVFAATYEGERPLAQQPNTIACASLRV LNSIPVSSGPGHYHYQQQSNQNLSRPQRPGSNQGYQMNNNRGFNGNNQQQHQNRRSFNNQSSSNPGNGSTGPRSSRSNEN VRDSSRQQNSQKGSSGVSVSKENVASTTGVPVDKKQQNSNRKDDGNRTKRSPMVQSPEPAKTKSEKTPMASSNVSQ
view sequence (1036 aa)
>GLD-2, isoform c
MPLSTGSIDSGFFGCTTNDSLKKGDIEDPQKTTPLSMTDEEETFSTSSSGFSQSSAPPLGDAILSSSNSTSSYLTLNSGA
YPRKHRTRVRRSNRKLKRLPQNMSMRFESSSLFSNTLTESLETASCCVSVAGSSRSSLSSSSNSANASYDDMVIRLYFYF
KSLLIAINHQKMICESIAYLVKDFDARWGNSGVRKKACDPKGCLAPIYTSSRNTDGGLDKKLVKPANFPMCWAVPQPAIF
YQLMAIDVVEYIKFLERISPQLKTQQQSPGIPIQNEAEASAVMKAMRSFQFHNWPQMSHGSYYPMPYHLENQMRPMKSGD
QLPLNQQNHNLSGFPAFVGKSSLVGSSLNTRNSSEADPEEMPRIMEKLDDEVTGADHDKTIDENRRRIHKSQEPRIGTEE
KALNELPRKANRRNSSCSSISSVSESSSPSALDESTLTKILPTDNFRGGRGFASPSPPTSLLSEPLSRMDVLSEKIWDYH
NKVSQTDEMLQRKLHLRDMLYTAISPVFPLSGLYVVGSSLNGFGNNSSDMDLCLMITNKDLDQKNDAVVVLNLILSTLQY
EKFVESQKLILAKVPILRINFAAPFDDITVDLNANNSVAIRNTHLLCYYSSYDWRVRPLVSVVKEWAKRKGINDANKSSF
TSYSLVLMVIHFLQCGPTKVLPNLQQSYPNRFSNKVDVRTLNVTMALEEVADDIDQSLSEKTTLGELLIGFLDYYANEFN
YDRDAISIRQGRRVERAALAVRPKIHSNSEGDKETPPPSSSASTSSIHNGGTPGIPMHHSISNPHFWRSQWRCVCIEEPF
TNSNTAHSIYDEMVFEAIKKAFREAHGELQHNHDLDKLMECEPIKASTTNTGAAVFAATYEGERPLAQQPNTIACASLRV
LNSIPVSSGPGHYHYQQQSNQNLSRPQRPGSNQGYQMNNNRGFNGNNQQQHQNRRSFNNQSSSNPGNGSTGPRSSRSNEN
VRDSSRQQNSQKGSSGVSVSKENVASTTGVPVDKKQQNSNRKDDGNRTKRSPMVQSPEPAKTKSEKTPMASSNVSQ
Estimated Isoelectric Point:
8.75571441650391
Estimated Molecular Weight:
115.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr53
Lys56
Gln51
Leu80
Gly53
Met29
Ser142
Tyr29
His24
Glu53
Arg60
Cys15
Phe35
Pro62
Val53
Asn76
Ala59
Ile46
Trp8
Asp52