Sequence:
download
CE33115sequence.fasta
>NHX-6, isoform a MSLIRRLSVVLIGLLLILGYAQAECDEKEEEVFPSRYPIAYFKWEEVKIPMTICLWLIAASISKIVFNSIPHLNDLFPDS ALLIMIGLIIGIIFKLIGVDKNQFFLESEIFMLYLLPPLVFDAGYFMPARQFFDNFGSIMCFAMIGTLFNFLAISFSLWA ISLTGLFSVETPLLHMLLFGSVAADVDPVAVIVIFEELAVNDVLFIAVFGESLFNDGVSVVLYRMFLTFSEIGAENLIPE DFANGGVSFLVVVFGGVGIGVLFAFLASLLTKYSRAEEISILNCVFILILPYTCYLCGELFGLSSIIAVVFCGALMRQYC RENVEQETVKATEKFIKVLSIASETVIFVFLGLSTVSSNHHWDTCFIVLTVVFCLIYRTLGVVVMCHFLNKYRLNKYTKV DQFIMAYGGLRGAIAYGLVVAIPDFIPAKNMFVTSCIIVIYFTVFLQGITLKPIAEFLQVEKKNVHSKNMIEHIYTELID TTMAGMEDIAGFKGHHWIRDSWNYFNNCYLRPVLVNKNNMKQMDKTKLVRKYKVGLGS
view sequence (538 aa)
>NHX-6, isoform a
MSLIRRLSVVLIGLLLILGYAQAECDEKEEEVFPSRYPIAYFKWEEVKIPMTICLWLIAASISKIVFNSIPHLNDLFPDS
ALLIMIGLIIGIIFKLIGVDKNQFFLESEIFMLYLLPPLVFDAGYFMPARQFFDNFGSIMCFAMIGTLFNFLAISFSLWA
ISLTGLFSVETPLLHMLLFGSVAADVDPVAVIVIFEELAVNDVLFIAVFGESLFNDGVSVVLYRMFLTFSEIGAENLIPE
DFANGGVSFLVVVFGGVGIGVLFAFLASLLTKYSRAEEISILNCVFILILPYTCYLCGELFGLSSIIAVVFCGALMRQYC
RENVEQETVKATEKFIKVLSIASETVIFVFLGLSTVSSNHHWDTCFIVLTVVFCLIYRTLGVVVMCHFLNKYRLNKYTKV
DQFIMAYGGLRGAIAYGLVVAIPDFIPAKNMFVTSCIIVIYFTVFLQGITLKPIAEFLQVEKKNVHSKNMIEHIYTELID
TTMAGMEDIAGFKGHHWIRDSWNYFNNCYLRPVLVNKNNMKQMDKTKLVRKYKVGLGS
Estimated Isoelectric Point:
5.67708587646484
Estimated Molecular Weight:
60.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr22
Lys25
Gln9
Leu65
Gly34
Met18
Ser32
Tyr20
His9
Glu29
Arg14
Cys13
Phe47
Pro16
Val52
Asn23
Ala33
Ile53
Trp6
Asp18