Sequence:
download
CE33055sequence.fasta
>INX-3 MLGVPFIDRWLSETFKPKTFDDAVDRLSYVTTATLLAFFSIMVSCKQYVGSAIQCWMPMEFKGGWEQYAEDYCFIQNTFF IPERSEIPGDVEDRQKAEIGYYQWVPIVLAIQAFMFYLPSWIWSSLYKQCGLDFPSVISEAEALRSQDSETRTKGVNKLV DFIGDILDTRSKNEYGRFYCYRFGKGLGSMTSMLYICIKLMYLANVFVQFIILNKFLGNETFLWGFHTFADLYAGREWQD SGVFPRVTLCDFSVRKLANVHRYTVQCVLMINMFNEKIYLFIWFWFVFVLITTFINTLCTIYRLSFDSSRHNYIRSLLSG PVNNFKDEKAMIASFANNGLKQDGVLLMRFIDDHAGAMVTKEICEELFKKHGENLQHNRDFHHGHSTKSTSPGLEEGHHE HLYTPEKMKLMAPDYPIKHA
view sequence (420 aa)
>INX-3
MLGVPFIDRWLSETFKPKTFDDAVDRLSYVTTATLLAFFSIMVSCKQYVGSAIQCWMPMEFKGGWEQYAEDYCFIQNTFF
IPERSEIPGDVEDRQKAEIGYYQWVPIVLAIQAFMFYLPSWIWSSLYKQCGLDFPSVISEAEALRSQDSETRTKGVNKLV
DFIGDILDTRSKNEYGRFYCYRFGKGLGSMTSMLYICIKLMYLANVFVQFIILNKFLGNETFLWGFHTFADLYAGREWQD
SGVFPRVTLCDFSVRKLANVHRYTVQCVLMINMFNEKIYLFIWFWFVFVLITTFINTLCTIYRLSFDSSRHNYIRSLLSG
PVNNFKDEKAMIASFANNGLKQDGVLLMRFIDDHAGAMVTKEICEELFKKHGENLQHNRDFHHGHSTKSTSPGLEEGHHE
HLYTPEKMKLMAPDYPIKHA
Estimated Isoelectric Point:
6.36078643798828
Estimated Molecular Weight:
48.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr22
Lys24
Gln14
Leu37
Gly25
Met15
Ser27
Tyr20
His13
Glu24
Arg18
Cys10
Phe35
Pro14
Val24
Asn17
Ala21
Ile28
Trp10
Asp22