Sequence:
download
CE33031sequence.fasta
>SRV-2 MHYTWVVAIQSAYISFSLILYFLIFIYIMWSGDPEFKTAFHRLFLLRAPADFIQVLVSLFAFRFPIVGWEEVTYIPHLAK MGFMISQYSVLVEMCAQLLLSINRLSAIVYPIQHNKFWTKKITLLLFLSGMILAIIPTASRASQPAAYIHVNGSFIPFLI DAGDQENNSKVTCIIYIFFCFFSLLCNMLACFVHRKQKRMQFFETQPKLASTVQTNLLIYACLSTVIVLAMTCFQSLLAF HVFDLSAKAYQIVLWLLTVSADAFALSNPWLLFCLSSTFRHKFLEARKIRRIFAAAPSTIETS
view sequence (303 aa)
>SRV-2
MHYTWVVAIQSAYISFSLILYFLIFIYIMWSGDPEFKTAFHRLFLLRAPADFIQVLVSLFAFRFPIVGWEEVTYIPHLAK
MGFMISQYSVLVEMCAQLLLSINRLSAIVYPIQHNKFWTKKITLLLFLSGMILAIIPTASRASQPAAYIHVNGSFIPFLI
DAGDQENNSKVTCIIYIFFCFFSLLCNMLACFVHRKQKRMQFFETQPKLASTVQTNLLIYACLSTVIVLAMTCFQSLLAF
HVFDLSAKAYQIVLWLLTVSADAFALSNPWLLFCLSSTFRHKFLEARKIRRIFAAAPSTIETS
Estimated Isoelectric Point:
9.19460296630859
Estimated Molecular Weight:
34.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr16
Lys12
Gln13
Leu39
Gly6
Met9
Ser25
Tyr11
His8
Glu8
Arg11
Cys8
Phe30
Pro11
Val18
Asn8
Ala29
Ile29
Trp6
Asp6