Sequence:
download
CE33018sequence.fasta
>UNC-22, isoform b MVGAPRFTQKPSIQQTPTGDLLMECHLEADPQPTIAWQHSGNLLEPSGRVVQTLTPLGGSLYKATLVIKEPNAGDGGAYK CTARNQLGESNANINLNFAGAGGDEAKSRGPSFVGKPRIIPKDGGALIVMECKVKSASTPVAKWMKDGVPLSMGGLYHAI FSDLGDQTYLCQLEIRGPSSSDAGQYRCNIRNDQGETNANLALNFEEPDPSERQERKRSTASPRPSSRGPGSRPSSPKKS MKSREGTPKRTLKPREGSPSKKLRSRTSTPVNEEVSQSESRRSSRTDKMEVDQVSGASKRKPDGLPPPGGDEKKLRAGSP STRKSPSRKSASPTPSRKGSSAGGAASGTTGASASATSATSGGSASSDASRDKYTRPPIVLEASRSQTGRIGGSVVLEVQ WQCHSSTIIEWYRDGTLVRNSSEYSQSFNGSIAKLQVNKLTEEKSGLYKCHAKCDYGEGQSSAMVKIEQSDVEEELMKHR KDAEDEYQKEEQKSQTLQAETKKRVARRSKSKSKSPAPQAKKSTTSESGRQEASEVEHKRSSSVRPDPDEESQLDEIPSS GLTIPEERRRELLGQVGESDDEVSESISELPSFAGGKPRRKTDSPPKQDDMFSRDTLLRKTTTSTKNESSTVEEKTKLRK TVKKVDGELDFKAMVKLKKVKKEEGGTTEKSGFPLDHADSTSSVLSQESRSRRGSNAPFAKDGLPEQPANPFAQLKKVKS GAGGLEKSDSMASLKKLDLKKGKIDDNSDGAFKVQLKKVVKKEVKESTISVKEKNGTESGIKTEFKMEKRERTTLQKYEK TDSDGSKKEDKPKKVSIAPVSTNKSSDDEPSTPRHHKEVEEKSTSEELKAKVAGRQVGQKRNGAQKPEEPKNLLSQIQLK KVTKKAHDDTNELEGIKLKKVTTVPKHVADDDSQSESESRRGSVFGELRRGSRAPRDSADNSRRDSIRRSSIDMRRESVQ EILEKTSTPLVPSGASGSAPKIVEVPENVTVVENETAILTCKVSGSPAPTFRWFKGSREVISGGRFKHITDGKEHTVALA LLKCRSQDEGPYTLTIENVHGTDSADVKLLVTSDNGLDFRAMLKHRESQAGFQKDGEGGGAGGGGGEKKPMTEAERRQSL FPGKKVEKWDIPLPEKTVQQQVDKICEWKCTYSRPNAKIRWYKDRKEIFSGGLKYKIVIEKNVCTLIINNPEVDDTGKYT CEANGVPTHAQLTVLEPPMKYSFLNPLPNTQEIYRTKQAVLTCKVNTPRAPLVWYRGSKAIQEGDPRFIIEKDAVGRCTL TIKEVEEDDQAEWTARITQDVFSKVQVYVEEPRHTFVVPMKSQKVNESDLATLETDVNDKDAEVVWWHDGKRIDIDGVKF KVESSNRKRRLIINGARIEDHGEYKCTTKDDRTMAQLIVDAKNKFIVALKDTEVIEKDDVTLMCQTKDTKTPGIWFRNGK QISSMPGGKFETQSRNGTHTLKIGKIEMNEADVYEIDQAGLRGSCNVTVLEAEKRPILNWKPKKIEAKAGEPCVVKVPFQ IKGTRRGDPKAQILKNGKPIDEEMRKLVEVIIKDDVAEIVFKNPQLADTGKWALELGNSAGTALAPFELFVKDKPKPPKG PLETKNVTAEGLDLVWGTPDPDEGAPVKAYIIEMQEGRSGNWAKVGETKGTDFKVKDLKEHGEYKFRVKALNECGLSDPL TGESVLAKNPYGVPGKPKNMDAIDVDKDHCTLAWEPPEEDGGAPITGYIIERREKSEKDWHQVGQTKPDCCELTDKKVVE DKEYLYRVKAVNKAGPGDPCDHGKPIKMKAKKASPEFTGGGIKDLRLKVGETIKYDVPISGEPLPECLWVVNGKPLKAVG RVKMSSERGKHIMKIENAVRADSGKFTITLKNSSGSCDSTATVTVVGRPTPPKGPLDIADVCADGATLSWNPPDDDGGDP LTGYIVEAQDMDNKGKYIEVGKVDPNTTTLKVNGLRNKGNYKFRVKAVNNEGESEPLSADQYTQIKDPWDEPGKPGRPEI TDFDADRIDIAWEPPHKDGGAPIEEYIVEVRDPDTKEWKEVKRVPDTNASISGLKEGKEYQFRVRAVNKAGPGQPSEPSE KQLAKPKFIPAWLKHDNLKSITVKAGATVRWEVKIGGEPIPEVKWFKGNQQLENGIQLTIDTRKNEHTILCIPSAMRSDV GEYRLTVKNSHGADEEKANLTVLDRPSKPNGPLEVSDVFEDNLNLSWKPPDDDGGEPIEYYEVEKLDTATGRWVPCAKVK DTKAHIDGLKKGQTYQFRVKAVNKEGASDALSTDKDTKAKNPYDEPGKTGTPDVVDWDADRVSLEWEPPKSDGGAPITQY VIEKKGKHGRDWQECGKVSGDQTNAEILGLKEGEEYQFRVKAVNKAGPGEASDPSRKVVAKPRNLKPWIDREAMKTITIK VGNDVEFDVPVRGEPPPKKEWIFNEKPVDDQKIRIESEDYKTRFVLRGATRKHAGLYTLTATNASGSDKHSVEVIVLGKP SSPLGPLEVSNVYEDRADLEWKVPEDDGGAPIDHYEIEKMDLATGRWVPCGRSETTKTTVPNLQPGHEYKFRVRAVNKEG ESDPLTTNTAILAKNPYEVPGKVDKPELVDWDKDHVDLAWNAPDDGGAPIEAFVIEKKDKNGRWEEALVVPGDQKTATVP NLKEGEEYQFRISARNKAGTGDPSDPSDRVVAKPRNLAPRIHREDLSDTTVKVGATLKFIVHIDGEPAPDVTWSFNGKGI GESKAQIENEPYISRFALPKALRKQSGKYTITATNINGTDSVTINIKVKSKPTKPKGPIEVTDVFEDRATLDWKPPEDDG GEPIEFYEIEKMNTKDGIWVPCGRSGDTHFTVDSLNKGDHYKFRVKAVNSEGPSDPLETETDILAKNPFDRPDRPGRPEP TDWDSDHVDLKWDPPLSDGGAPIEEYQIEKRTKYGRWEPAITVPGGQTTATVPDLTPNEEYEFRVVAVNKGGPSDPSDAS KAVIAKPRNLKPHIDRDALKNLTIKAGQSISFDVPVSGEPAPTVTWHWPDNREIRNGGRVKLDNPEYQSKLVVKQMERGD SGTFTIKAVNANGEDEATVKINVIDKPTSPNGPLDVSDVHGDHVTLNWRAPDDDGGIPIENYVIEKYDTASGRWVPAAKV AGDKTTAVVDGLIPGHEYKFRVAAVNAEGESDPLETFGTTLAKDPFDKPGKTNAPEITDWDKDHVDLEWKPPANDGGAPI EEYVVEMKDEFSPFWNDVAHVPAGQTNATVGNLKEGSKYEFRIRAKNKAGLGDPSDSASAVAKARNVPPVIDRNSIQEIK VKAGQDFSLNIPVSGEPTPTITWTFEGTPVESDDRMKLNNEDGKTKFHVKRALRSDTGTYIIKAENENGTDTAEVKVTVL DHPSSPRGPLDVTNIVKDGCDLAWKEPEDDGGAEISHYVIEKQDAATGRWTACGESKDTNFHVDDLTQGHEYKFRVKAVN RHGDSDPLEAREAIIAKDPFDRADKPGTPEIVDWDKDHADLKWTPPADDGGAPIEGYLVEMRTPSGDWVPAVTVGAGELT ATVDGLKPGQTYQFRVKALNKAGESTPSDPSRTMVAKPRHLAPKINRDMFVAQRVKAGQTLNFDVNVEGEPAPKIEWFLN GSPLSSGGNTHIDNNTDNNTKLTTKSTARADSGKYKIVATNESGKDEHEVDVNILDIPGAPEGPLRHKDITKESVVLKWD EPLDDGGSPITNYVVEKQEDGGRWVPCGETSDTSLKVNKLSEGHEYKFRVKAVNRQGTSAPLTSDHAIVAKNPFDEPDAP TDVTPVDWDKDHVDLEWKPPANDGGAPIDAYIVEKKDKFGDWVECARVDGKTTKATADNLTPGETYQFRVKAVNKAGPGK PSDPTGNVVAKPRRMAPKLNLAGLLDLRIKAGTPIKLDIAFEGEPAPVAKWKANDATIDTGARADVTNTPTSSAIHIFSA VRGDTGVYKIIVENEHGKDTAQCNVTVLDVPGTPEGPLKIDEIHKEGCTLNWKPPTDNGGTDVLHYIVEKMDTSRGTWQE VGTFPDCTAKVNKLVPGKEYAFRVKAVNLQGESKPLEAEEPIIAKNQFDVPDPVDKPEVTDWDKDRIDIKWNPTANNGGA PVTGYIVEKKEKGSAIWTEAGKTPGTTFSADNLKPGVEYEFRVIAVNAAGPSDPSDPTDPQITKARYLKPKILTASRKIK IKAGFTHNLEVDFIGAPDPTATWTVGDSGAALAPELLVDAKSSTTSIFFPSAKRADSGNYKLKVKNELGEDEAIFEVIVQ DRPSAPEGPLEVSDVTKDSCVLNWKPPKDDGGAEISNYVVEKRDTKTNTWVPVSAFVTGTSITVPKLTEGHEYEFRVMAE NTFGRSDSLNTDEPVLAKDPFGTPGKPGRPEIVDTDNDHIDIKWDPPRDNGGSPVDHYDIERKDAKTGRWIKVNTSPVQG TAFSDTRVQKGHTYEYRVVAVNKAGPGQPSDSSAAATAKPMHEAPKFDLDLDGKEFRVKAGEPLVITIPFTASPQPDISW TKEGGKPLAGVETTDSQTKLVIPSTRRSDSGPVKIKAVNPYGEAEANIKITVIDKPGAPENITYPAVSRHTCTLNWDAPK DDGGAEIAGYKIEYQEVGSQIWDKVPGLISGTAYTVRGLEHGQQYRFRIRAENAVGLSDYCQGVPVVIKDPFDPPGAPST PEITGYDTNQVSLAWNPPRDDGGSPILGYVVERFEKRGGGDWAPVKMPMVKGTECIVPGLHENETYQFRVRAVNAAGHGE PSNGSEPVTCRPYVEKPGAPDAPRVGKITKNSAELTWNRPLRDGGAPIDGYIVEKKKLGDNDWTRCNDKPVRDTAFEVKN LGEKEEYEFRVIAVNSAGEGEPSKPSDLVLIEEQPGRPIFDINNLKDITVRAGETIQIRIPYAGGNPKPIIDLFNGNSPI FENERTVVDVNPGEIVITTTGSKRSDAGPYKISATNKYGKDTCKLNVFVLDAPGKPTGPIRATDIQADAMTLSWRPPKDN GGDAITNYVVEKRTPGGDWVTVGHPVGTTLRVRNLDANTPYEFRVRAENQYGVGEPLETDDAIVAKNPFDTPGAPGQPEA VETSEEAITLQWTRPTSDGGAPIQGYVIEKREVGSTEWTKAAFGNILDTKHRVTGLTPKKTYEFRVAAYNAAGQGEYSVN SVPITADNAPTRPKINMGMLTRDILAYAGERAKILVPFAASPAPKVTFSKGENKISPTDPRVKVEYSDFLATLTIEKSEL TDGGLYFVELENSQGSDSASIRLKVVDKPASPQHIRVEDIAPDCCTLYWMPPSSDGGSPITNYIVEKLDLRHSDGKWEKV SSFVRNLNYTVGGLIKDNRYRFRVRAETQYGVSEPCELADVVVAKYQFEVPNQPEAPTVRDKDSTWAELEWDPPRDGGSK IIGYQVQYRDTSSGRWINAKMDLSEQCHARVTGLRQNGEFEFRIIAKNAAGFSKPSPPSERCQLKSRFGPPGPPIHVGAK SIGRNHCTITWMAPLEDGGSKITGYNVEIREYGSTLWTVASDYNVREPEFTVDKLREFNDYEFRVVAINAAGKGIPSLPS GPIKIQESGGSRPQIVVKPEDTAQPYNRRAVFTCEAVGRPEPTARWLRNGRELPESSRYRFEASDGVYKFTIKEVWDIDA GEYTVEVSNPYGSDTATANLVVQAPPVIEKDVPNTILPSGDLVRLKIYFSGTAPFRHSLVLNREEIDMDHPTIRIVEFDD HILITIPALSVREAGRYEYTVSNDSGEATTGFWLNVTGLPEAPQGPLHISNIGPSTATLSWRPPVTDGGSKITSYVVEKR DLSKDEWVTVTSNVKDMNYIVTGLFENHEYEFRVSAQNENGIGAPLVSEHPIIARLPFDPPTSPLNLEIVQVGGDYVTLS WQRPLSDGGGRLRGYIVEKQEEEHDEWFRCNQNPSPPNNYNVPNLIDGRKYRYRVFAVNDAGLSDLAELDQTLFQASGSG EGPKIVSPLSDLNEEVGRCVTFECEISGSPRPEYRWFKGCKELVDTSKYTLINKGDKQVLIINDLTSDDADEYTCRATNS SGTRSTRANLRIKTKPRVFIPPKYHGGYEAQKGETIELKIPYKAYPQGEARWTKDGEKIENNSKFSITTDDKFATLRISN ASREDYGEYRVVVENSVGSDSGTVNVTVADVPEPPRFPIIENILDEAVILSWKPPALDGGSLVTNYTIEKREAMGGSWSP CAKSRYTYTTIEGLRAGKQYEFRIIAENKHGQSKPCEPTAPVLIPGDERKRRRGYDVDEQGKIVRGKGTVSSNYDNYVFD IWKQYYPQPVEIKHDHVLDHYDIHEELGTGAFGVVHRVTERATGNNFAAKFVMTPHESDKETVRKEIQTMSVLRHPTLVN LHDAFEDDNEMVMIYEFMSGGELFEKVADEHNKMSEDEAVEYMRQVCKGLCHMHENNYVHLDLKPENIMFTTKRSNELKL IDFGLTAHLDPKQSVKVTTGTAEFAAPEVAEGKPVGYYTDMWSVGVLSYILLSGLSPFGGENDDETLRNVKSCDWNMDDS AFSGISEDGKDFIRKLLLADPNTRMTIHQALEHPWLTPGNAPGRDSQIPSSRYTKIRDSIKTKYDAWPEPLPPLGRISNY SSLRKHRPQEYSIRDAFWDRSEAQPRFIVKPYGTEVGEGQSANFYCRVIASSPPVVTWHKDDRELKQSVKYMKRYNGNDY GLTINRVKGDDKGEYTVRAKNSYGTKEEIVFLNVTRHSEPLKFEPLEPMKKAPSPPRVEEFKERRSAPFFTFHLRNRLIQ KNHQCKLTCSLQGNPNPTIEWMKDGHPVDEDRVQVSFRSGVCSLEIFNARVDDAGTYTVTATNDLGVDVSECVLTVQTKG GEPIPRVSSFRPRRAYDTLSTGTDVERSHSYADMRRRSLIRDVSPDVRSAADDLKTKITNELPSFTAQLSDSETEVGGSA EFSAAVSGQPEPLIEWLHNGERISESDSRFRASYVAGKATLRISDAKKSDEGQYLCRASNSAGQEQTRATLTVKGDQPLL NGHAGQAVESELRVTKHLGGEIVNNGESVTFEARVQGTPEEVLWMRNGQELTNGDKTSISQDGETLSFTINSADASDAGH YQLEVRSKGTNLVSVASLVVVGEKADPPVTRLPSSVSAPLGGSTAFTIEFENVEGLTVQWFRGSEKIEKNERVKSVKTGN TFKLDIKNVEQDDDGIYVAKVVKEKKAIAKYAAALLLV
view sequence (7158 aa)
>UNC-22, isoform b
MVGAPRFTQKPSIQQTPTGDLLMECHLEADPQPTIAWQHSGNLLEPSGRVVQTLTPLGGSLYKATLVIKEPNAGDGGAYK
CTARNQLGESNANINLNFAGAGGDEAKSRGPSFVGKPRIIPKDGGALIVMECKVKSASTPVAKWMKDGVPLSMGGLYHAI
FSDLGDQTYLCQLEIRGPSSSDAGQYRCNIRNDQGETNANLALNFEEPDPSERQERKRSTASPRPSSRGPGSRPSSPKKS
MKSREGTPKRTLKPREGSPSKKLRSRTSTPVNEEVSQSESRRSSRTDKMEVDQVSGASKRKPDGLPPPGGDEKKLRAGSP
STRKSPSRKSASPTPSRKGSSAGGAASGTTGASASATSATSGGSASSDASRDKYTRPPIVLEASRSQTGRIGGSVVLEVQ
WQCHSSTIIEWYRDGTLVRNSSEYSQSFNGSIAKLQVNKLTEEKSGLYKCHAKCDYGEGQSSAMVKIEQSDVEEELMKHR
KDAEDEYQKEEQKSQTLQAETKKRVARRSKSKSKSPAPQAKKSTTSESGRQEASEVEHKRSSSVRPDPDEESQLDEIPSS
GLTIPEERRRELLGQVGESDDEVSESISELPSFAGGKPRRKTDSPPKQDDMFSRDTLLRKTTTSTKNESSTVEEKTKLRK
TVKKVDGELDFKAMVKLKKVKKEEGGTTEKSGFPLDHADSTSSVLSQESRSRRGSNAPFAKDGLPEQPANPFAQLKKVKS
GAGGLEKSDSMASLKKLDLKKGKIDDNSDGAFKVQLKKVVKKEVKESTISVKEKNGTESGIKTEFKMEKRERTTLQKYEK
TDSDGSKKEDKPKKVSIAPVSTNKSSDDEPSTPRHHKEVEEKSTSEELKAKVAGRQVGQKRNGAQKPEEPKNLLSQIQLK
KVTKKAHDDTNELEGIKLKKVTTVPKHVADDDSQSESESRRGSVFGELRRGSRAPRDSADNSRRDSIRRSSIDMRRESVQ
EILEKTSTPLVPSGASGSAPKIVEVPENVTVVENETAILTCKVSGSPAPTFRWFKGSREVISGGRFKHITDGKEHTVALA
LLKCRSQDEGPYTLTIENVHGTDSADVKLLVTSDNGLDFRAMLKHRESQAGFQKDGEGGGAGGGGGEKKPMTEAERRQSL
FPGKKVEKWDIPLPEKTVQQQVDKICEWKCTYSRPNAKIRWYKDRKEIFSGGLKYKIVIEKNVCTLIINNPEVDDTGKYT
CEANGVPTHAQLTVLEPPMKYSFLNPLPNTQEIYRTKQAVLTCKVNTPRAPLVWYRGSKAIQEGDPRFIIEKDAVGRCTL
TIKEVEEDDQAEWTARITQDVFSKVQVYVEEPRHTFVVPMKSQKVNESDLATLETDVNDKDAEVVWWHDGKRIDIDGVKF
KVESSNRKRRLIINGARIEDHGEYKCTTKDDRTMAQLIVDAKNKFIVALKDTEVIEKDDVTLMCQTKDTKTPGIWFRNGK
QISSMPGGKFETQSRNGTHTLKIGKIEMNEADVYEIDQAGLRGSCNVTVLEAEKRPILNWKPKKIEAKAGEPCVVKVPFQ
IKGTRRGDPKAQILKNGKPIDEEMRKLVEVIIKDDVAEIVFKNPQLADTGKWALELGNSAGTALAPFELFVKDKPKPPKG
PLETKNVTAEGLDLVWGTPDPDEGAPVKAYIIEMQEGRSGNWAKVGETKGTDFKVKDLKEHGEYKFRVKALNECGLSDPL
TGESVLAKNPYGVPGKPKNMDAIDVDKDHCTLAWEPPEEDGGAPITGYIIERREKSEKDWHQVGQTKPDCCELTDKKVVE
DKEYLYRVKAVNKAGPGDPCDHGKPIKMKAKKASPEFTGGGIKDLRLKVGETIKYDVPISGEPLPECLWVVNGKPLKAVG
RVKMSSERGKHIMKIENAVRADSGKFTITLKNSSGSCDSTATVTVVGRPTPPKGPLDIADVCADGATLSWNPPDDDGGDP
LTGYIVEAQDMDNKGKYIEVGKVDPNTTTLKVNGLRNKGNYKFRVKAVNNEGESEPLSADQYTQIKDPWDEPGKPGRPEI
TDFDADRIDIAWEPPHKDGGAPIEEYIVEVRDPDTKEWKEVKRVPDTNASISGLKEGKEYQFRVRAVNKAGPGQPSEPSE
KQLAKPKFIPAWLKHDNLKSITVKAGATVRWEVKIGGEPIPEVKWFKGNQQLENGIQLTIDTRKNEHTILCIPSAMRSDV
GEYRLTVKNSHGADEEKANLTVLDRPSKPNGPLEVSDVFEDNLNLSWKPPDDDGGEPIEYYEVEKLDTATGRWVPCAKVK
DTKAHIDGLKKGQTYQFRVKAVNKEGASDALSTDKDTKAKNPYDEPGKTGTPDVVDWDADRVSLEWEPPKSDGGAPITQY
VIEKKGKHGRDWQECGKVSGDQTNAEILGLKEGEEYQFRVKAVNKAGPGEASDPSRKVVAKPRNLKPWIDREAMKTITIK
VGNDVEFDVPVRGEPPPKKEWIFNEKPVDDQKIRIESEDYKTRFVLRGATRKHAGLYTLTATNASGSDKHSVEVIVLGKP
SSPLGPLEVSNVYEDRADLEWKVPEDDGGAPIDHYEIEKMDLATGRWVPCGRSETTKTTVPNLQPGHEYKFRVRAVNKEG
ESDPLTTNTAILAKNPYEVPGKVDKPELVDWDKDHVDLAWNAPDDGGAPIEAFVIEKKDKNGRWEEALVVPGDQKTATVP
NLKEGEEYQFRISARNKAGTGDPSDPSDRVVAKPRNLAPRIHREDLSDTTVKVGATLKFIVHIDGEPAPDVTWSFNGKGI
GESKAQIENEPYISRFALPKALRKQSGKYTITATNINGTDSVTINIKVKSKPTKPKGPIEVTDVFEDRATLDWKPPEDDG
GEPIEFYEIEKMNTKDGIWVPCGRSGDTHFTVDSLNKGDHYKFRVKAVNSEGPSDPLETETDILAKNPFDRPDRPGRPEP
TDWDSDHVDLKWDPPLSDGGAPIEEYQIEKRTKYGRWEPAITVPGGQTTATVPDLTPNEEYEFRVVAVNKGGPSDPSDAS
KAVIAKPRNLKPHIDRDALKNLTIKAGQSISFDVPVSGEPAPTVTWHWPDNREIRNGGRVKLDNPEYQSKLVVKQMERGD
SGTFTIKAVNANGEDEATVKINVIDKPTSPNGPLDVSDVHGDHVTLNWRAPDDDGGIPIENYVIEKYDTASGRWVPAAKV
AGDKTTAVVDGLIPGHEYKFRVAAVNAEGESDPLETFGTTLAKDPFDKPGKTNAPEITDWDKDHVDLEWKPPANDGGAPI
EEYVVEMKDEFSPFWNDVAHVPAGQTNATVGNLKEGSKYEFRIRAKNKAGLGDPSDSASAVAKARNVPPVIDRNSIQEIK
VKAGQDFSLNIPVSGEPTPTITWTFEGTPVESDDRMKLNNEDGKTKFHVKRALRSDTGTYIIKAENENGTDTAEVKVTVL
DHPSSPRGPLDVTNIVKDGCDLAWKEPEDDGGAEISHYVIEKQDAATGRWTACGESKDTNFHVDDLTQGHEYKFRVKAVN
RHGDSDPLEAREAIIAKDPFDRADKPGTPEIVDWDKDHADLKWTPPADDGGAPIEGYLVEMRTPSGDWVPAVTVGAGELT
ATVDGLKPGQTYQFRVKALNKAGESTPSDPSRTMVAKPRHLAPKINRDMFVAQRVKAGQTLNFDVNVEGEPAPKIEWFLN
GSPLSSGGNTHIDNNTDNNTKLTTKSTARADSGKYKIVATNESGKDEHEVDVNILDIPGAPEGPLRHKDITKESVVLKWD
EPLDDGGSPITNYVVEKQEDGGRWVPCGETSDTSLKVNKLSEGHEYKFRVKAVNRQGTSAPLTSDHAIVAKNPFDEPDAP
TDVTPVDWDKDHVDLEWKPPANDGGAPIDAYIVEKKDKFGDWVECARVDGKTTKATADNLTPGETYQFRVKAVNKAGPGK
PSDPTGNVVAKPRRMAPKLNLAGLLDLRIKAGTPIKLDIAFEGEPAPVAKWKANDATIDTGARADVTNTPTSSAIHIFSA
VRGDTGVYKIIVENEHGKDTAQCNVTVLDVPGTPEGPLKIDEIHKEGCTLNWKPPTDNGGTDVLHYIVEKMDTSRGTWQE
VGTFPDCTAKVNKLVPGKEYAFRVKAVNLQGESKPLEAEEPIIAKNQFDVPDPVDKPEVTDWDKDRIDIKWNPTANNGGA
PVTGYIVEKKEKGSAIWTEAGKTPGTTFSADNLKPGVEYEFRVIAVNAAGPSDPSDPTDPQITKARYLKPKILTASRKIK
IKAGFTHNLEVDFIGAPDPTATWTVGDSGAALAPELLVDAKSSTTSIFFPSAKRADSGNYKLKVKNELGEDEAIFEVIVQ
DRPSAPEGPLEVSDVTKDSCVLNWKPPKDDGGAEISNYVVEKRDTKTNTWVPVSAFVTGTSITVPKLTEGHEYEFRVMAE
NTFGRSDSLNTDEPVLAKDPFGTPGKPGRPEIVDTDNDHIDIKWDPPRDNGGSPVDHYDIERKDAKTGRWIKVNTSPVQG
TAFSDTRVQKGHTYEYRVVAVNKAGPGQPSDSSAAATAKPMHEAPKFDLDLDGKEFRVKAGEPLVITIPFTASPQPDISW
TKEGGKPLAGVETTDSQTKLVIPSTRRSDSGPVKIKAVNPYGEAEANIKITVIDKPGAPENITYPAVSRHTCTLNWDAPK
DDGGAEIAGYKIEYQEVGSQIWDKVPGLISGTAYTVRGLEHGQQYRFRIRAENAVGLSDYCQGVPVVIKDPFDPPGAPST
PEITGYDTNQVSLAWNPPRDDGGSPILGYVVERFEKRGGGDWAPVKMPMVKGTECIVPGLHENETYQFRVRAVNAAGHGE
PSNGSEPVTCRPYVEKPGAPDAPRVGKITKNSAELTWNRPLRDGGAPIDGYIVEKKKLGDNDWTRCNDKPVRDTAFEVKN
LGEKEEYEFRVIAVNSAGEGEPSKPSDLVLIEEQPGRPIFDINNLKDITVRAGETIQIRIPYAGGNPKPIIDLFNGNSPI
FENERTVVDVNPGEIVITTTGSKRSDAGPYKISATNKYGKDTCKLNVFVLDAPGKPTGPIRATDIQADAMTLSWRPPKDN
GGDAITNYVVEKRTPGGDWVTVGHPVGTTLRVRNLDANTPYEFRVRAENQYGVGEPLETDDAIVAKNPFDTPGAPGQPEA
VETSEEAITLQWTRPTSDGGAPIQGYVIEKREVGSTEWTKAAFGNILDTKHRVTGLTPKKTYEFRVAAYNAAGQGEYSVN
SVPITADNAPTRPKINMGMLTRDILAYAGERAKILVPFAASPAPKVTFSKGENKISPTDPRVKVEYSDFLATLTIEKSEL
TDGGLYFVELENSQGSDSASIRLKVVDKPASPQHIRVEDIAPDCCTLYWMPPSSDGGSPITNYIVEKLDLRHSDGKWEKV
SSFVRNLNYTVGGLIKDNRYRFRVRAETQYGVSEPCELADVVVAKYQFEVPNQPEAPTVRDKDSTWAELEWDPPRDGGSK
IIGYQVQYRDTSSGRWINAKMDLSEQCHARVTGLRQNGEFEFRIIAKNAAGFSKPSPPSERCQLKSRFGPPGPPIHVGAK
SIGRNHCTITWMAPLEDGGSKITGYNVEIREYGSTLWTVASDYNVREPEFTVDKLREFNDYEFRVVAINAAGKGIPSLPS
GPIKIQESGGSRPQIVVKPEDTAQPYNRRAVFTCEAVGRPEPTARWLRNGRELPESSRYRFEASDGVYKFTIKEVWDIDA
GEYTVEVSNPYGSDTATANLVVQAPPVIEKDVPNTILPSGDLVRLKIYFSGTAPFRHSLVLNREEIDMDHPTIRIVEFDD
HILITIPALSVREAGRYEYTVSNDSGEATTGFWLNVTGLPEAPQGPLHISNIGPSTATLSWRPPVTDGGSKITSYVVEKR
DLSKDEWVTVTSNVKDMNYIVTGLFENHEYEFRVSAQNENGIGAPLVSEHPIIARLPFDPPTSPLNLEIVQVGGDYVTLS
WQRPLSDGGGRLRGYIVEKQEEEHDEWFRCNQNPSPPNNYNVPNLIDGRKYRYRVFAVNDAGLSDLAELDQTLFQASGSG
EGPKIVSPLSDLNEEVGRCVTFECEISGSPRPEYRWFKGCKELVDTSKYTLINKGDKQVLIINDLTSDDADEYTCRATNS
SGTRSTRANLRIKTKPRVFIPPKYHGGYEAQKGETIELKIPYKAYPQGEARWTKDGEKIENNSKFSITTDDKFATLRISN
ASREDYGEYRVVVENSVGSDSGTVNVTVADVPEPPRFPIIENILDEAVILSWKPPALDGGSLVTNYTIEKREAMGGSWSP
CAKSRYTYTTIEGLRAGKQYEFRIIAENKHGQSKPCEPTAPVLIPGDERKRRRGYDVDEQGKIVRGKGTVSSNYDNYVFD
IWKQYYPQPVEIKHDHVLDHYDIHEELGTGAFGVVHRVTERATGNNFAAKFVMTPHESDKETVRKEIQTMSVLRHPTLVN
LHDAFEDDNEMVMIYEFMSGGELFEKVADEHNKMSEDEAVEYMRQVCKGLCHMHENNYVHLDLKPENIMFTTKRSNELKL
IDFGLTAHLDPKQSVKVTTGTAEFAAPEVAEGKPVGYYTDMWSVGVLSYILLSGLSPFGGENDDETLRNVKSCDWNMDDS
AFSGISEDGKDFIRKLLLADPNTRMTIHQALEHPWLTPGNAPGRDSQIPSSRYTKIRDSIKTKYDAWPEPLPPLGRISNY
SSLRKHRPQEYSIRDAFWDRSEAQPRFIVKPYGTEVGEGQSANFYCRVIASSPPVVTWHKDDRELKQSVKYMKRYNGNDY
GLTINRVKGDDKGEYTVRAKNSYGTKEEIVFLNVTRHSEPLKFEPLEPMKKAPSPPRVEEFKERRSAPFFTFHLRNRLIQ
KNHQCKLTCSLQGNPNPTIEWMKDGHPVDEDRVQVSFRSGVCSLEIFNARVDDAGTYTVTATNDLGVDVSECVLTVQTKG
GEPIPRVSSFRPRRAYDTLSTGTDVERSHSYADMRRRSLIRDVSPDVRSAADDLKTKITNELPSFTAQLSDSETEVGGSA
EFSAAVSGQPEPLIEWLHNGERISESDSRFRASYVAGKATLRISDAKKSDEGQYLCRASNSAGQEQTRATLTVKGDQPLL
NGHAGQAVESELRVTKHLGGEIVNNGESVTFEARVQGTPEEVLWMRNGQELTNGDKTSISQDGETLSFTINSADASDAGH
YQLEVRSKGTNLVSVASLVVVGEKADPPVTRLPSSVSAPLGGSTAFTIEFENVEGLTVQWFRGSEKIEKNERVKSVKTGN
TFKLDIKNVEQDDDGIYVAKVVKEKKAIAKYAAALLLV
Estimated Isoelectric Point:
5.78528594970703
Estimated Molecular Weight:
788.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr488
Lys605
Gln189
Leu394
Gly577
Met71
Ser479
Tyr183
His119
Glu567
Arg380
Cys70
Phe185
Pro518
Val540
Asn312
Ala483
Ile358
Trp115
Asp525