Sequence:
download
CE33017sequence.fasta
>UNC-22, isoform a MVGAPRFTQKPSIQQTPTGDLLMECHLEADPQPTIAWQHSGNLLEPSGRVVQTLTPLGGSLYKATLVIKEPNAGDGGAYK CTARNQLGESNANINLNFAGAGGDEAKSRGPSFVGKPRIIPKDGGALIVMECKVKSASTPVAKWMKDGVPLSMGGLYHAI FSDLGDQTYLCQLEIRGPSSSDAGQYRCNIRNDQGETNANLALNFEEPDPSERQERKRSTASPRPSSRGPGSRPSSPKKS MKSREGTPKRTLKPREGSPSKKLRSRTSTPVNEEVSQSESRRSSRTDKMEVDQVSGASKRKPDGLPPPGGDEKKLRAGSP STRKSPSRKSASPTPSRKGSSAGGAASGTTGASASATSATSGGSASSDASRDKYTRPPIVLEASRSQTGRIGGSVVLEVQ WQCHSSTIIEWYRDGTLVRNSSEYSQSFNGSIAKLQVNKLTEEKSGLYKCHAKCDYGEGQSSAMVKIEQSDVEEELMKHR KDAEDEYQKEEQKSQTLQAETKKRVARRSKSKSKSPAPQAKKSTTSESGRQEASEVEHKRSSSVRPDPDEESQLDEIPSS GLTIPEERRRELLGQVGESDDEVSESISELPSFAGGKPRRKTDDKPKKVSIAPVSTNKSSDDEPSTPRRRSSIDMRRESV QEILEKTSTPLVPSGASGSAPKIVEVPENVTVVENETAILTCKVSGSPAPTFRWFKGSREVISGGRFKHITDGKEHTVAL ALLKCRSQDEGPYTLTIENVHGTDSADVKLLVTSDNGLDFRAMLKHRESQAGFQKDGEGGGAGGGGGEKKPMTEAERRQS LFPGKKVEKWDIPLPEKTVQQQVDKICEWKCTYSRPNAKIRWYKDRKEIFSGGLKYKIVIEKNVCTLIINNPEVDDTGKY TCEANGVPTHAQLTVLEPPMKYSFLNPLPNTQEIYRTKQAVLTCKVNTPRAPLVWYRGSKAIQEGDPRFIIEKDAVGRCT LTIKEVEEDDQAEWTARITQDVFSKVQVYVEEPRHTFVVPMKSQKVNESDLATLETDVNDKDAEVVWWHDGKRIDIDGVK FKVESSNRKRRLIINGARIEDHGEYKCTTKDDRTMAQLIVDAKNKFIVALKDTEVIEKDDVTLMCQTKDTKTPGIWFRNG KQISSMPGGKFETQSRNGTHTLKIGKIEMNEADVYEIDQAGLRGSCNVTVLEAEKRPILNWKPKKIEAKAGEPCVVKVPF QIKGTRRGDPKAQILKNGKPIDEEMRKLVEVIIKDDVAEIVFKNPQLADTGKWALELGNSAGTALAPFELFVKDKPKPPK GPLETKNVTAEGLDLVWGTPDPDEGAPVKAYIIEMQEGRSGNWAKVGETKGTDFKVKDLKEHGEYKFRVKALNECGLSDP LTGESVLAKNPYGVPGKPKNMDAIDVDKDHCTLAWEPPEEDGGAPITGYIIERREKSEKDWHQVGQTKPDCCELTDKKVV EDKEYLYRVKAVNKAGPGDPCDHGKPIKMKAKKASPEFTGGGIKDLRLKVGETIKYDVPISGEPLPECLWVVNGKPLKAV GRVKMSSERGKHIMKIENAVRADSGKFTITLKNSSGSCDSTATVTVVGRPTPPKGPLDIADVCADGATLSWNPPDDDGGD PLTGYIVEAQDMDNKGKYIEVGKVDPNTTTLKVNGLRNKGNYKFRVKAVNNEGESEPLSADQYTQIKDPWDEPGKPGRPE ITDFDADRIDIAWEPPHKDGGAPIEEYIVEVRDPDTKEWKEVKRVPDTNASISGLKEGKEYQFRVRAVNKAGPGQPSEPS EKQLAKPKFIPAWLKHDNLKSITVKAGATVRWEVKIGGEPIPEVKWFKGNQQLENGIQLTIDTRKNEHTILCIPSAMRSD VGEYRLTVKNSHGADEEKANLTVLDRPSKPNGPLEVSDVFEDNLNLSWKPPDDDGGEPIEYYEVEKLDTATGRWVPCAKV KDTKAHIDGLKKGQTYQFRVKAVNKEGASDALSTDKDTKAKNPYDEPGKTGTPDVVDWDADRVSLEWEPPKSDGGAPITQ YVIEKKGKHGRDWQECGKVSGDQTNAEILGLKEGEEYQFRVKAVNKAGPGEASDPSRKVVAKPRNLKPWIDREAMKTITI KVGNDVEFDVPVRGEPPPKKEWIFNEKPVDDQKIRIESEDYKTRFVLRGATRKHAGLYTLTATNASGSDKHSVEVIVLGK PSSPLGPLEVSNVYEDRADLEWKVPEDDGGAPIDHYEIEKMDLATGRWVPCGRSETTKTTVPNLQPGHEYKFRVRAVNKE GESDPLTTNTAILAKNPYEVPGKVDKPELVDWDKDHVDLAWNAPDDGGAPIEAFVIEKKDKNGRWEEALVVPGDQKTATV PNLKEGEEYQFRISARNKAGTGDPSDPSDRVVAKPRNLAPRIHREDLSDTTVKVGATLKFIVHIDGEPAPDVTWSFNGKG IGESKAQIENEPYISRFALPKALRKQSGKYTITATNINGTDSVTINIKVKSKPTKPKGPIEVTDVFEDRATLDWKPPEDD GGEPIEFYEIEKMNTKDGIWVPCGRSGDTHFTVDSLNKGDHYKFRVKAVNSEGPSDPLETETDILAKNPFDRPDRPGRPE PTDWDSDHVDLKWDPPLSDGGAPIEEYQIEKRTKYGRWEPAITVPGGQTTATVPDLTPNEEYEFRVVAVNKGGPSDPSDA SKAVIAKPRNLKPHIDRDALKNLTIKAGQSISFDVPVSGEPAPTVTWHWPDNREIRNGGRVKLDNPEYQSKLVVKQMERG DSGTFTIKAVNANGEDEATVKINVIDKPTSPNGPLDVSDVHGDHVTLNWRAPDDDGGIPIENYVIEKYDTASGRWVPAAK VAGDKTTAVVDGLIPGHEYKFRVAAVNAEGESDPLETFGTTLAKDPFDKPGKTNAPEITDWDKDHVDLEWKPPANDGGAP IEEYVVEMKDEFSPFWNDVAHVPAGQTNATVGNLKEGSKYEFRIRAKNKAGLGDPSDSASAVAKARNVPPVIDRNSIQEI KVKAGQDFSLNIPVSGEPTPTITWTFEGTPVESDDRMKLNNEDGKTKFHVKRALRSDTGTYIIKAENENGTDTAEVKVTV LDHPSSPRGPLDVTNIVKDGCDLAWKEPEDDGGAEISHYVIEKQDAATGRWTACGESKDTNFHVDDLTQGHEYKFRVKAV NRHGDSDPLEAREAIIAKDPFDRADKPGTPEIVDWDKDHADLKWTPPADDGGAPIEGYLVEMRTPSGDWVPAVTVGAGEL TATVDGLKPGQTYQFRVKALNKAGESTPSDPSRTMVAKPRHLAPKINRDMFVAQRVKAGQTLNFDVNVEGEPAPKIEWFL NGSPLSSGGNTHIDNNTDNNTKLTTKSTARADSGKYKIVATNESGKDEHEVDVNILDIPGAPEGPLRHKDITKESVVLKW DEPLDDGGSPITNYVVEKQEDGGRWVPCGETSDTSLKVNKLSEGHEYKFRVKAVNRQGTSAPLTSDHAIVAKNPFDEPDA PTDVTPVDWDKDHVDLEWKPPANDGGAPIDAYIVEKKDKFGDWVECARVDGKTTKATADNLTPGETYQFRVKAVNKAGPG KPSDPTGNVVAKPRRMAPKLNLAGLLDLRIKAGTPIKLDIAFEGEPAPVAKWKANDATIDTGARADVTNTPTSSAIHIFS AVRGDTGVYKIIVENEHGKDTAQCNVTVLDVPGTPEGPLKIDEIHKEGCTLNWKPPTDNGGTDVLHYIVEKMDTSRGTWQ EVGTFPDCTAKVNKLVPGKEYAFRVKAVNLQGESKPLEAEEPIIAKNQFDVPDPVDKPEVTDWDKDRIDIKWNPTANNGG APVTGYIVEKKEKGSAIWTEAGKTPGTTFSADNLKPGVEYEFRVIAVNAAGPSDPSDPTDPQITKARYLKPKILTASRKI KIKAGFTHNLEVDFIGAPDPTATWTVGDSGAALAPELLVDAKSSTTSIFFPSAKRADSGNYKLKVKNELGEDEAIFEVIV QDRPSAPEGPLEVSDVTKDSCVLNWKPPKDDGGAEISNYVVEKRDTKTNTWVPVSAFVTGTSITVPKLTEGHEYEFRVMA ENTFGRSDSLNTDEPVLAKDPFGTPGKPGRPEIVDTDNDHIDIKWDPPRDNGGSPVDHYDIERKDAKTGRWIKVNTSPVQ GTAFSDTRVQKGHTYEYRVVAVNKAGPGQPSDSSAAATAKPMHEAPKFDLDLDGKEFRVKAGEPLVITIPFTASPQPDIS WTKEGGKPLAGVETTDSQTKLVIPSTRRSDSGPVKIKAVNPYGEAEANIKITVIDKPGAPENITYPAVSRHTCTLNWDAP KDDGGAEIAGYKIEYQEVGSQIWDKVPGLISGTAYTVRGLEHGQQYRFRIRAENAVGLSDYCQGVPVVIKDPFDPPGAPS TPEITGYDTNQVSLAWNPPRDDGGSPILGYVVERFEKRGGGDWAPVKMPMVKGTECIVPGLHENETYQFRVRAVNAAGHG EPSNGSEPVTCRPYVEKPGAPDAPRVGKITKNSAELTWNRPLRDGGAPIDGYIVEKKKLGDNDWTRCNDKPVRDTAFEVK NLGEKEEYEFRVIAVNSAGEGEPSKPSDLVLIEEQPGRPIFDINNLKDITVRAGETIQIRIPYAGGNPKPIIDLFNGNSP IFENERTVVDVNPGEIVITTTGSKRSDAGPYKISATNKYGKDTCKLNVFVLDAPGKPTGPIRATDIQADAMTLSWRPPKD NGGDAITNYVVEKRTPGGDWVTVGHPVGTTLRVRNLDANTPYEFRVRAENQYGVGEPLETDDAIVAKNPFDTPGAPGQPE AVETSEEAITLQWTRPTSDGGAPIQGYVIEKREVGSTEWTKAAFGNILDTKHRVTGLTPKKTYEFRVAAYNAAGQGEYSV NSVPITADNAPTRPKINMGMLTRDILAYAGERAKILVPFAASPAPKVTFSKGENKISPTDPRVKVEYSDFLATLTIEKSE LTDGGLYFVELENSQGSDSASIRLKVVDKPASPQHIRVEDIAPDCCTLYWMPPSSDGGSPITNYIVEKLDLRHSDGKWEK VSSFVRNLNYTVGGLIKDNRYRFRVRAETQYGVSEPCELADVVVAKYQFEVPNQPEAPTVRDKDSTWAELEWDPPRDGGS KIIGYQVQYRDTSSGRWINAKMDLSEQCHARVTGLRQNGEFEFRIIAKNAAGFSKPSPPSERCQLKSRFGPPGPPIHVGA KSIGRNHCTITWMAPLEDGGSKITGYNVEIREYGSTLWTVASDYNVREPEFTVDKLREFNDYEFRVVAINAAGKGIPSLP SGPIKIQESGGSRPQIVVKPEDTAQPYNRRAVFTCEAVGRPEPTARWLRNGRELPESSRYRFEASDGVYKFTIKEVWDID AGEYTVEVSNPYGSDTATANLVVQAPPVIEKDVPNTILPSGDLVRLKIYFSGTAPFRHSLVLNREEIDMDHPTIRIVEFD DHILITIPALSVREAGRYEYTVSNDSGEATTGFWLNVTGLPEAPQGPLHISNIGPSTATLSWRPPVTDGGSKITSYVVEK RDLSKDEWVTVTSNVKDMNYIVTGLFENHEYEFRVSAQNENGIGAPLVSEHPIIARLPFDPPTSPLNLEIVQVGGDYVTL SWQRPLSDGGGRLRGYIVEKQEEEHDEWFRCNQNPSPPNNYNVPNLIDGRKYRYRVFAVNDAGLSDLAELDQTLFQASGS GEGPKIVSPLSDLNEEVGRCVTFECEISGSPRPEYRWFKGCKELVDTSKYTLINKGDKQVLIINDLTSDDADEYTCRATN SSGTRSTRANLRIKTKPRVFIPPKYHGGYEAQKGETIELKIPYKAYPQGEARWTKDGEKIENNSKFSITTDDKFATLRIS NASREDYGEYRVVVENSVGSDSGTVNVTVADVPEPPRFPIIENILDEAVILSWKPPALDGGSLVTNYTIEKREAMGGSWS PCAKSRYTYTTIEGLRAGKQYEFRIIAENKHGQSKPCEPTAPVLIPGDERKRRRGYDVDEQGKIVRGKGTVSSNYDNYVF DIWKQYYPQPVEIKHDHVLDHYDIHEELGTGAFGVVHRVTERATGNNFAAKFVMTPHESDKETVRKEIQTMSVLRHPTLV NLHDAFEDDNEMVMIYEFMSGGELFEKVADEHNKMSEDEAVEYMRQVCKGLCHMHENNYVHLDLKPENIMFTTKRSNELK LIDFGLTAHLDPKQSVKVTTGTAEFAAPEVAEGKPVGYYTDMWSVGVLSYILLSGLSPFGGENDDETLRNVKSCDWNMDD SAFSGISEDGKDFIRKLLLADPNTRMTIHQALEHPWLTPGNAPGRDSQIPSSRYTKIRDSIKTKYDAWPEPLPPLGRISN YSSLRKHRPQEYSIRDAFWDRSEAQPRFIVKPYGTEVGEGQSANFYCRVIASSPPVVTWHKDDRELKQSVKYMKRYNGND YGLTINRVKGDDKGEYTVRAKNSYGTKEEIVFLNVTRHSEPLKFEPLEPMKKAPSPPRVEEFKERRSAPFFTFHLRNRLI QKNHQCKLTCSLQGNPNPTIEWMKDGHPVDEDRVQVSFRSGVCSLEIFNARVDDAGTYTVTATNDLGVDVSECVLTVQTK GGEPIPRVSSFRPRRAYDTLSTGTDVERSHSYADMRRRSLIRDVSPDVRSAADDLKTKITNELPSFTAQLSDSETEVGGS AEFSAAVSGQPEPLIEWLHNGERISESDSRFRASYVAGKATLRISDAKKSDEGQYLCRASNSAGQEQTRATLTVKGDQPL LNGHAGQAVESELRVTKHLGGEIVNNGESVTFEARVQGTPEEVLWMRNGQELTNGDKTSISQDGETLSFTINSADASDAG HYQLEVRSKGTNLVSVASLVVVGEKADPPVTRLPSSVSAPLGGSTAFTIEFENVEGLTVQWFRGSEKIEKNERVKSVKTG NTFKLDIKNVEQDDDGIYVAKVVKEKKAIAKYAAALLLV
view sequence (6839 aa)
>UNC-22, isoform a
MVGAPRFTQKPSIQQTPTGDLLMECHLEADPQPTIAWQHSGNLLEPSGRVVQTLTPLGGSLYKATLVIKEPNAGDGGAYK
CTARNQLGESNANINLNFAGAGGDEAKSRGPSFVGKPRIIPKDGGALIVMECKVKSASTPVAKWMKDGVPLSMGGLYHAI
FSDLGDQTYLCQLEIRGPSSSDAGQYRCNIRNDQGETNANLALNFEEPDPSERQERKRSTASPRPSSRGPGSRPSSPKKS
MKSREGTPKRTLKPREGSPSKKLRSRTSTPVNEEVSQSESRRSSRTDKMEVDQVSGASKRKPDGLPPPGGDEKKLRAGSP
STRKSPSRKSASPTPSRKGSSAGGAASGTTGASASATSATSGGSASSDASRDKYTRPPIVLEASRSQTGRIGGSVVLEVQ
WQCHSSTIIEWYRDGTLVRNSSEYSQSFNGSIAKLQVNKLTEEKSGLYKCHAKCDYGEGQSSAMVKIEQSDVEEELMKHR
KDAEDEYQKEEQKSQTLQAETKKRVARRSKSKSKSPAPQAKKSTTSESGRQEASEVEHKRSSSVRPDPDEESQLDEIPSS
GLTIPEERRRELLGQVGESDDEVSESISELPSFAGGKPRRKTDDKPKKVSIAPVSTNKSSDDEPSTPRRRSSIDMRRESV
QEILEKTSTPLVPSGASGSAPKIVEVPENVTVVENETAILTCKVSGSPAPTFRWFKGSREVISGGRFKHITDGKEHTVAL
ALLKCRSQDEGPYTLTIENVHGTDSADVKLLVTSDNGLDFRAMLKHRESQAGFQKDGEGGGAGGGGGEKKPMTEAERRQS
LFPGKKVEKWDIPLPEKTVQQQVDKICEWKCTYSRPNAKIRWYKDRKEIFSGGLKYKIVIEKNVCTLIINNPEVDDTGKY
TCEANGVPTHAQLTVLEPPMKYSFLNPLPNTQEIYRTKQAVLTCKVNTPRAPLVWYRGSKAIQEGDPRFIIEKDAVGRCT
LTIKEVEEDDQAEWTARITQDVFSKVQVYVEEPRHTFVVPMKSQKVNESDLATLETDVNDKDAEVVWWHDGKRIDIDGVK
FKVESSNRKRRLIINGARIEDHGEYKCTTKDDRTMAQLIVDAKNKFIVALKDTEVIEKDDVTLMCQTKDTKTPGIWFRNG
KQISSMPGGKFETQSRNGTHTLKIGKIEMNEADVYEIDQAGLRGSCNVTVLEAEKRPILNWKPKKIEAKAGEPCVVKVPF
QIKGTRRGDPKAQILKNGKPIDEEMRKLVEVIIKDDVAEIVFKNPQLADTGKWALELGNSAGTALAPFELFVKDKPKPPK
GPLETKNVTAEGLDLVWGTPDPDEGAPVKAYIIEMQEGRSGNWAKVGETKGTDFKVKDLKEHGEYKFRVKALNECGLSDP
LTGESVLAKNPYGVPGKPKNMDAIDVDKDHCTLAWEPPEEDGGAPITGYIIERREKSEKDWHQVGQTKPDCCELTDKKVV
EDKEYLYRVKAVNKAGPGDPCDHGKPIKMKAKKASPEFTGGGIKDLRLKVGETIKYDVPISGEPLPECLWVVNGKPLKAV
GRVKMSSERGKHIMKIENAVRADSGKFTITLKNSSGSCDSTATVTVVGRPTPPKGPLDIADVCADGATLSWNPPDDDGGD
PLTGYIVEAQDMDNKGKYIEVGKVDPNTTTLKVNGLRNKGNYKFRVKAVNNEGESEPLSADQYTQIKDPWDEPGKPGRPE
ITDFDADRIDIAWEPPHKDGGAPIEEYIVEVRDPDTKEWKEVKRVPDTNASISGLKEGKEYQFRVRAVNKAGPGQPSEPS
EKQLAKPKFIPAWLKHDNLKSITVKAGATVRWEVKIGGEPIPEVKWFKGNQQLENGIQLTIDTRKNEHTILCIPSAMRSD
VGEYRLTVKNSHGADEEKANLTVLDRPSKPNGPLEVSDVFEDNLNLSWKPPDDDGGEPIEYYEVEKLDTATGRWVPCAKV
KDTKAHIDGLKKGQTYQFRVKAVNKEGASDALSTDKDTKAKNPYDEPGKTGTPDVVDWDADRVSLEWEPPKSDGGAPITQ
YVIEKKGKHGRDWQECGKVSGDQTNAEILGLKEGEEYQFRVKAVNKAGPGEASDPSRKVVAKPRNLKPWIDREAMKTITI
KVGNDVEFDVPVRGEPPPKKEWIFNEKPVDDQKIRIESEDYKTRFVLRGATRKHAGLYTLTATNASGSDKHSVEVIVLGK
PSSPLGPLEVSNVYEDRADLEWKVPEDDGGAPIDHYEIEKMDLATGRWVPCGRSETTKTTVPNLQPGHEYKFRVRAVNKE
GESDPLTTNTAILAKNPYEVPGKVDKPELVDWDKDHVDLAWNAPDDGGAPIEAFVIEKKDKNGRWEEALVVPGDQKTATV
PNLKEGEEYQFRISARNKAGTGDPSDPSDRVVAKPRNLAPRIHREDLSDTTVKVGATLKFIVHIDGEPAPDVTWSFNGKG
IGESKAQIENEPYISRFALPKALRKQSGKYTITATNINGTDSVTINIKVKSKPTKPKGPIEVTDVFEDRATLDWKPPEDD
GGEPIEFYEIEKMNTKDGIWVPCGRSGDTHFTVDSLNKGDHYKFRVKAVNSEGPSDPLETETDILAKNPFDRPDRPGRPE
PTDWDSDHVDLKWDPPLSDGGAPIEEYQIEKRTKYGRWEPAITVPGGQTTATVPDLTPNEEYEFRVVAVNKGGPSDPSDA
SKAVIAKPRNLKPHIDRDALKNLTIKAGQSISFDVPVSGEPAPTVTWHWPDNREIRNGGRVKLDNPEYQSKLVVKQMERG
DSGTFTIKAVNANGEDEATVKINVIDKPTSPNGPLDVSDVHGDHVTLNWRAPDDDGGIPIENYVIEKYDTASGRWVPAAK
VAGDKTTAVVDGLIPGHEYKFRVAAVNAEGESDPLETFGTTLAKDPFDKPGKTNAPEITDWDKDHVDLEWKPPANDGGAP
IEEYVVEMKDEFSPFWNDVAHVPAGQTNATVGNLKEGSKYEFRIRAKNKAGLGDPSDSASAVAKARNVPPVIDRNSIQEI
KVKAGQDFSLNIPVSGEPTPTITWTFEGTPVESDDRMKLNNEDGKTKFHVKRALRSDTGTYIIKAENENGTDTAEVKVTV
LDHPSSPRGPLDVTNIVKDGCDLAWKEPEDDGGAEISHYVIEKQDAATGRWTACGESKDTNFHVDDLTQGHEYKFRVKAV
NRHGDSDPLEAREAIIAKDPFDRADKPGTPEIVDWDKDHADLKWTPPADDGGAPIEGYLVEMRTPSGDWVPAVTVGAGEL
TATVDGLKPGQTYQFRVKALNKAGESTPSDPSRTMVAKPRHLAPKINRDMFVAQRVKAGQTLNFDVNVEGEPAPKIEWFL
NGSPLSSGGNTHIDNNTDNNTKLTTKSTARADSGKYKIVATNESGKDEHEVDVNILDIPGAPEGPLRHKDITKESVVLKW
DEPLDDGGSPITNYVVEKQEDGGRWVPCGETSDTSLKVNKLSEGHEYKFRVKAVNRQGTSAPLTSDHAIVAKNPFDEPDA
PTDVTPVDWDKDHVDLEWKPPANDGGAPIDAYIVEKKDKFGDWVECARVDGKTTKATADNLTPGETYQFRVKAVNKAGPG
KPSDPTGNVVAKPRRMAPKLNLAGLLDLRIKAGTPIKLDIAFEGEPAPVAKWKANDATIDTGARADVTNTPTSSAIHIFS
AVRGDTGVYKIIVENEHGKDTAQCNVTVLDVPGTPEGPLKIDEIHKEGCTLNWKPPTDNGGTDVLHYIVEKMDTSRGTWQ
EVGTFPDCTAKVNKLVPGKEYAFRVKAVNLQGESKPLEAEEPIIAKNQFDVPDPVDKPEVTDWDKDRIDIKWNPTANNGG
APVTGYIVEKKEKGSAIWTEAGKTPGTTFSADNLKPGVEYEFRVIAVNAAGPSDPSDPTDPQITKARYLKPKILTASRKI
KIKAGFTHNLEVDFIGAPDPTATWTVGDSGAALAPELLVDAKSSTTSIFFPSAKRADSGNYKLKVKNELGEDEAIFEVIV
QDRPSAPEGPLEVSDVTKDSCVLNWKPPKDDGGAEISNYVVEKRDTKTNTWVPVSAFVTGTSITVPKLTEGHEYEFRVMA
ENTFGRSDSLNTDEPVLAKDPFGTPGKPGRPEIVDTDNDHIDIKWDPPRDNGGSPVDHYDIERKDAKTGRWIKVNTSPVQ
GTAFSDTRVQKGHTYEYRVVAVNKAGPGQPSDSSAAATAKPMHEAPKFDLDLDGKEFRVKAGEPLVITIPFTASPQPDIS
WTKEGGKPLAGVETTDSQTKLVIPSTRRSDSGPVKIKAVNPYGEAEANIKITVIDKPGAPENITYPAVSRHTCTLNWDAP
KDDGGAEIAGYKIEYQEVGSQIWDKVPGLISGTAYTVRGLEHGQQYRFRIRAENAVGLSDYCQGVPVVIKDPFDPPGAPS
TPEITGYDTNQVSLAWNPPRDDGGSPILGYVVERFEKRGGGDWAPVKMPMVKGTECIVPGLHENETYQFRVRAVNAAGHG
EPSNGSEPVTCRPYVEKPGAPDAPRVGKITKNSAELTWNRPLRDGGAPIDGYIVEKKKLGDNDWTRCNDKPVRDTAFEVK
NLGEKEEYEFRVIAVNSAGEGEPSKPSDLVLIEEQPGRPIFDINNLKDITVRAGETIQIRIPYAGGNPKPIIDLFNGNSP
IFENERTVVDVNPGEIVITTTGSKRSDAGPYKISATNKYGKDTCKLNVFVLDAPGKPTGPIRATDIQADAMTLSWRPPKD
NGGDAITNYVVEKRTPGGDWVTVGHPVGTTLRVRNLDANTPYEFRVRAENQYGVGEPLETDDAIVAKNPFDTPGAPGQPE
AVETSEEAITLQWTRPTSDGGAPIQGYVIEKREVGSTEWTKAAFGNILDTKHRVTGLTPKKTYEFRVAAYNAAGQGEYSV
NSVPITADNAPTRPKINMGMLTRDILAYAGERAKILVPFAASPAPKVTFSKGENKISPTDPRVKVEYSDFLATLTIEKSE
LTDGGLYFVELENSQGSDSASIRLKVVDKPASPQHIRVEDIAPDCCTLYWMPPSSDGGSPITNYIVEKLDLRHSDGKWEK
VSSFVRNLNYTVGGLIKDNRYRFRVRAETQYGVSEPCELADVVVAKYQFEVPNQPEAPTVRDKDSTWAELEWDPPRDGGS
KIIGYQVQYRDTSSGRWINAKMDLSEQCHARVTGLRQNGEFEFRIIAKNAAGFSKPSPPSERCQLKSRFGPPGPPIHVGA
KSIGRNHCTITWMAPLEDGGSKITGYNVEIREYGSTLWTVASDYNVREPEFTVDKLREFNDYEFRVVAINAAGKGIPSLP
SGPIKIQESGGSRPQIVVKPEDTAQPYNRRAVFTCEAVGRPEPTARWLRNGRELPESSRYRFEASDGVYKFTIKEVWDID
AGEYTVEVSNPYGSDTATANLVVQAPPVIEKDVPNTILPSGDLVRLKIYFSGTAPFRHSLVLNREEIDMDHPTIRIVEFD
DHILITIPALSVREAGRYEYTVSNDSGEATTGFWLNVTGLPEAPQGPLHISNIGPSTATLSWRPPVTDGGSKITSYVVEK
RDLSKDEWVTVTSNVKDMNYIVTGLFENHEYEFRVSAQNENGIGAPLVSEHPIIARLPFDPPTSPLNLEIVQVGGDYVTL
SWQRPLSDGGGRLRGYIVEKQEEEHDEWFRCNQNPSPPNNYNVPNLIDGRKYRYRVFAVNDAGLSDLAELDQTLFQASGS
GEGPKIVSPLSDLNEEVGRCVTFECEISGSPRPEYRWFKGCKELVDTSKYTLINKGDKQVLIINDLTSDDADEYTCRATN
SSGTRSTRANLRIKTKPRVFIPPKYHGGYEAQKGETIELKIPYKAYPQGEARWTKDGEKIENNSKFSITTDDKFATLRIS
NASREDYGEYRVVVENSVGSDSGTVNVTVADVPEPPRFPIIENILDEAVILSWKPPALDGGSLVTNYTIEKREAMGGSWS
PCAKSRYTYTTIEGLRAGKQYEFRIIAENKHGQSKPCEPTAPVLIPGDERKRRRGYDVDEQGKIVRGKGTVSSNYDNYVF
DIWKQYYPQPVEIKHDHVLDHYDIHEELGTGAFGVVHRVTERATGNNFAAKFVMTPHESDKETVRKEIQTMSVLRHPTLV
NLHDAFEDDNEMVMIYEFMSGGELFEKVADEHNKMSEDEAVEYMRQVCKGLCHMHENNYVHLDLKPENIMFTTKRSNELK
LIDFGLTAHLDPKQSVKVTTGTAEFAAPEVAEGKPVGYYTDMWSVGVLSYILLSGLSPFGGENDDETLRNVKSCDWNMDD
SAFSGISEDGKDFIRKLLLADPNTRMTIHQALEHPWLTPGNAPGRDSQIPSSRYTKIRDSIKTKYDAWPEPLPPLGRISN
YSSLRKHRPQEYSIRDAFWDRSEAQPRFIVKPYGTEVGEGQSANFYCRVIASSPPVVTWHKDDRELKQSVKYMKRYNGND
YGLTINRVKGDDKGEYTVRAKNSYGTKEEIVFLNVTRHSEPLKFEPLEPMKKAPSPPRVEEFKERRSAPFFTFHLRNRLI
QKNHQCKLTCSLQGNPNPTIEWMKDGHPVDEDRVQVSFRSGVCSLEIFNARVDDAGTYTVTATNDLGVDVSECVLTVQTK
GGEPIPRVSSFRPRRAYDTLSTGTDVERSHSYADMRRRSLIRDVSPDVRSAADDLKTKITNELPSFTAQLSDSETEVGGS
AEFSAAVSGQPEPLIEWLHNGERISESDSRFRASYVAGKATLRISDAKKSDEGQYLCRASNSAGQEQTRATLTVKGDQPL
LNGHAGQAVESELRVTKHLGGEIVNNGESVTFEARVQGTPEEVLWMRNGQELTNGDKTSISQDGETLSFTINSADASDAG
HYQLEVRSKGTNLVSVASLVVVGEKADPPVTRLPSSVSAPLGGSTAFTIEFENVEGLTVQWFRGSEKIEKNERVKSVKTG
NTFKLDIKNVEQDDDGIYVAKVVKEKKAIAKYAAALLLV
Estimated Isoelectric Point:
5.62229156494141
Estimated Molecular Weight:
753.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr466
Lys550
Gln177
Leu372
Gly556
Met67
Ser444
Tyr182
His114
Glu536
Arg362
Cys70
Phe177
Pro507
Val520
Asn303
Ala467
Ile352
Trp115
Asp502