Sequence:
download
CE33016sequence.fasta
>UNC-13, isoform g MNPVPSLAVPMSPGPYLNSDPPSPVSPNPQIKRSIYRIKESYEDRNGGRERIYTTNLVSVYLEKMKPPDELEEGSSGSMR ETQNEIKNGTQLHNAESNIFFPQDSVPKSISYNAGNLKNTSITTSKTSSAITNHSSLPPQPPSKPASRDSDPMKQLLTFS KSFKKVRRVRSAMPRRRKRKRVKIKKSRSCPILWKTEKTPHPMKSKSMTCIRIPKKTVIAPLRKEIKIVRMKPPAARCES DSKAHKKKNLLDVYKDMGKSTVLDGNGSSAANAFYKSIDAAPNMNVARTKTSIPLVSELTMATKRAQAGLANAARTTFSD TELKTHVYKKTLQALIYPISATTPHNFATTTFQTPTFCYECEGLLWGLARQGLRCTQCQVKVHDKCRELLSADCLQRAAE KSTKHGEADRTQSLVNVIRDRMKIQEQNKPEVFQMIRTVFDVDENIQKETLKTVKASILEGSSKWSAKITLTVLCAQGLI AKDKTGKSDPYVTAQVGKTKRRTRTIHQELNPVWNEKFHFECHNSTDRIKVRVWDEDNDLKSKLRQKLTRESDDFLGQTV IEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLHINVEIKGEEKLAPYHVQYTCLHEHLFAAHCVDEEVKLPKVRGEDSWKV CFQETGQEIAEEFAMRYGIESIYQAMTHFACLCTRYMCAGVPAVLSTLLANINAYYAHTTATSAVSAPDRFAASNFGKER FVKLLDQLHNSLRIDLSAYRNHFPSSSPAKLQDLKSTVDLLTSITFFRMKVLELASPPRASTVVRECAKACMQQTYQLMF ESCAEQFPILDTSVQFWYEFIDYIMRVIEEDQKNYTPALNQFPQELNVGNLSAETLWSMYKNDLKMALEEHAQKKRCKTP EYMNLYFKVKGFYFKYVADLSTYKSSIPEFPAWFIPFVMDWLNENDEHSMDILRNAYNVDKADNFPQTSEHTKFSNSVVD VFTQLNAALKLLKQMDCPNPEVAADMMKRFSKTLNKVLLAYADMVQKDFPKFAHDEKLACILMNNVQQLRVQLEKIYETM GGAELDEHIGQVLTVLQKKLNSVLDRLSAEFVTTLEPHIHEQTIKLGMLLVKIKGPQLQKTQVQPEADAVLEPLMDLLEG SLRRYADQCEKTVLKYILKELWKITIVNMEKRVVLPPLSDKALLKQLPNAKIGDVTKLMSTNIQSIKGMNSVKDMMDMAR ESEKSLTPRQCTVLDCALDAIKDSFHASGKGLKKSFFEKSPELQSLKYALSLYTQTTEQLIKTFITSQRQQDLPSQEQPV GEVSVQVDLFSHPGTGEQKVTVKILAANDLRWQTSSAFKPFVEVHLVGPHLSDKKRKWSTKTKAGNWAPKFNETFHFFLG NEGEPEHYELMFQVKDYCFARDDRVVGVGVLQLSSVVDQAGSCAMWVQLGTRLHIDETGLILLRILSQRQTDEVAKDFVR LKTECRYETETVMAASASSQNINRT
view sequence (1465 aa)
>UNC-13, isoform g
MNPVPSLAVPMSPGPYLNSDPPSPVSPNPQIKRSIYRIKESYEDRNGGRERIYTTNLVSVYLEKMKPPDELEEGSSGSMR
ETQNEIKNGTQLHNAESNIFFPQDSVPKSISYNAGNLKNTSITTSKTSSAITNHSSLPPQPPSKPASRDSDPMKQLLTFS
KSFKKVRRVRSAMPRRRKRKRVKIKKSRSCPILWKTEKTPHPMKSKSMTCIRIPKKTVIAPLRKEIKIVRMKPPAARCES
DSKAHKKKNLLDVYKDMGKSTVLDGNGSSAANAFYKSIDAAPNMNVARTKTSIPLVSELTMATKRAQAGLANAARTTFSD
TELKTHVYKKTLQALIYPISATTPHNFATTTFQTPTFCYECEGLLWGLARQGLRCTQCQVKVHDKCRELLSADCLQRAAE
KSTKHGEADRTQSLVNVIRDRMKIQEQNKPEVFQMIRTVFDVDENIQKETLKTVKASILEGSSKWSAKITLTVLCAQGLI
AKDKTGKSDPYVTAQVGKTKRRTRTIHQELNPVWNEKFHFECHNSTDRIKVRVWDEDNDLKSKLRQKLTRESDDFLGQTV
IEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLHINVEIKGEEKLAPYHVQYTCLHEHLFAAHCVDEEVKLPKVRGEDSWKV
CFQETGQEIAEEFAMRYGIESIYQAMTHFACLCTRYMCAGVPAVLSTLLANINAYYAHTTATSAVSAPDRFAASNFGKER
FVKLLDQLHNSLRIDLSAYRNHFPSSSPAKLQDLKSTVDLLTSITFFRMKVLELASPPRASTVVRECAKACMQQTYQLMF
ESCAEQFPILDTSVQFWYEFIDYIMRVIEEDQKNYTPALNQFPQELNVGNLSAETLWSMYKNDLKMALEEHAQKKRCKTP
EYMNLYFKVKGFYFKYVADLSTYKSSIPEFPAWFIPFVMDWLNENDEHSMDILRNAYNVDKADNFPQTSEHTKFSNSVVD
VFTQLNAALKLLKQMDCPNPEVAADMMKRFSKTLNKVLLAYADMVQKDFPKFAHDEKLACILMNNVQQLRVQLEKIYETM
GGAELDEHIGQVLTVLQKKLNSVLDRLSAEFVTTLEPHIHEQTIKLGMLLVKIKGPQLQKTQVQPEADAVLEPLMDLLEG
SLRRYADQCEKTVLKYILKELWKITIVNMEKRVVLPPLSDKALLKQLPNAKIGDVTKLMSTNIQSIKGMNSVKDMMDMAR
ESEKSLTPRQCTVLDCALDAIKDSFHASGKGLKKSFFEKSPELQSLKYALSLYTQTTEQLIKTFITSQRQQDLPSQEQPV
GEVSVQVDLFSHPGTGEQKVTVKILAANDLRWQTSSAFKPFVEVHLVGPHLSDKKRKWSTKTKAGNWAPKFNETFHFFLG
NEGEPEHYELMFQVKDYCFARDDRVVGVGVLQLSSVVDQAGSCAMWVQLGTRLHIDETGLILLRILSQRQTDEVAKDFVR
LKTECRYETETVMAASASSQNINRT
Estimated Isoelectric Point:
9.05510711669922
Estimated Molecular Weight:
166.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr101
Lys131
Gln74
Leu135
Gly52
Met44
Ser112
Tyr41
His34
Glu96
Arg73
Cys29
Phe56
Pro71
Val97
Asn62
Ala101
Ile66
Trp16
Asp74