Sequence:
download
CE32946sequence.fasta
>GRK-2 MADLEAVLADVSYLMAMEKSRSQPAARASKRIVLPDPSVRSIMQKFLEKSGDMKFDKIFNQKLGFLLLKDYAENVSESPC PQIKFYEAIKEYEKMETPDERLTKAREIYDHHIMVEMLAHAHNYSKESLQHVQYHLLKQNVPPDLFHRYVLEICDQLRGD IFQRFLESDKFTRFCQWKNLELNMQLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNER IMLSLVSTGQDCPFIVCMTYAFQSPDKLCFILDLMNGGDLHYHLSQHGVFTEQEMIFYASEVILGLEHMHNRFVVYRDLK PANILLDENGHVRVSDLGLACDYSKKKPHASVGTHGYMAPEVLAKGVAYDSSADWFSLGCMLYKLLKGHSPFRQHKSKDK NEIDKMTLTQDIELPNEGLSKDCRDLLEGLLKRDVPDRLGCRGKGPTEVKEHPFFKDVDWQTVYLRRMTPPLIPPRGEVN AADAFDIGNFDDDEVKGVKLQDGDSDLYKNFNIVISERWQNEIAETIFEVVNQDADKAESKKRSKQKIKVAVEEKDSDVI VHGYIKKLGGPFTSAWQTKYGKLYPSRLELYPESLTAKPELVFMDQIEDVCAEMQTIKGETAIIVKLRDGFKEPKICLTN SDEISLKEWHTSLRTAHKVSQELLQRMGRKAIKIYGVNHDPMLSESERPGSVTRAFLNRASSVDSGV
view sequence (707 aa)
>GRK-2
MADLEAVLADVSYLMAMEKSRSQPAARASKRIVLPDPSVRSIMQKFLEKSGDMKFDKIFNQKLGFLLLKDYAENVSESPC
PQIKFYEAIKEYEKMETPDERLTKAREIYDHHIMVEMLAHAHNYSKESLQHVQYHLLKQNVPPDLFHRYVLEICDQLRGD
IFQRFLESDKFTRFCQWKNLELNMQLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNER
IMLSLVSTGQDCPFIVCMTYAFQSPDKLCFILDLMNGGDLHYHLSQHGVFTEQEMIFYASEVILGLEHMHNRFVVYRDLK
PANILLDENGHVRVSDLGLACDYSKKKPHASVGTHGYMAPEVLAKGVAYDSSADWFSLGCMLYKLLKGHSPFRQHKSKDK
NEIDKMTLTQDIELPNEGLSKDCRDLLEGLLKRDVPDRLGCRGKGPTEVKEHPFFKDVDWQTVYLRRMTPPLIPPRGEVN
AADAFDIGNFDDDEVKGVKLQDGDSDLYKNFNIVISERWQNEIAETIFEVVNQDADKAESKKRSKQKIKVAVEEKDSDVI
VHGYIKKLGGPFTSAWQTKYGKLYPSRLELYPESLTAKPELVFMDQIEDVCAEMQTIKGETAIIVKLRDGFKEPKICLTN
SDEISLKEWHTSLRTAHKVSQELLQRMGRKAIKIYGVNHDPMLSESERPGSVTRAFLNRASSVDSGV
Estimated Isoelectric Point:
6.56020355224609
Estimated Molecular Weight:
81.0 kD
Amino Acid Composition:
Amino Acid Frequency
Thr25
Lys63
Gln28
Leu69
Gly41
Met26
Ser45
Tyr25
His23
Glu52
Arg36
Cys14
Phe30
Pro29
Val44
Asn23
Ala39
Ile37
Trp6
Asp52