Sequence:
download
CE32766sequence.fasta
>GLD-2, isoform a MVMAQQQKNAERNDEHTRRNRSPSVDSVSRVQQQSGGFAFYNQQSNHQYQQSHPRRTSFSRDGNTGYYNNHSGNKRQTYN NQRGGRSYNHRGNSNYQQNGEYSGNQGCVPKYHQRNQNYPQLQPKYSYFQPHQRPIFNSTQGYGTYSVRRSSPPSPSALS SSTANSTSNRAPTQPPILLRHAEPASDKNHQGSDHEQNHDPKIHLYRSAGTAPGGYTQCPSPYKQPPPQPPSTPSSSDKR IEQQQAEDWPTRFQHPPPQFRRGQDPMPASIELQHKTANQTMPVDIVQTNQQKTVSSYERAAQFRASASELPTDSVDAKH PCFANERMQSALIGISPQLKTQQQSPGIPIQNEAEASAVMKAMRSFQFHNWPQMSHGSYYPMPYHLENQMRPMKSGDQLP LNQQNHNLSGFPAFVGKSSLVGSSLNTRNSSEADPEEMPRIMEKLDDEVTGADHDKTIDENRRRIHKSQEPRIGTEEKAL NELPRKANRRNSSCSSISSVSESSSPSALDESTLTKILPTDNFRGGRGFASPSPPTSLLSEPLSRMDVLSEKIWDYHNKV SQTDEMLQRKLHLRDMLYTAISPVFPLSGLYVVGSSLNGFGNNSSDMDLCLMITNKDLDQKNDAVVVLNLILSTLQYEKF VESQKLILAKVPILRINFAAPFDDITVDLNANNSVAIRNTHLLCYYSSYDWRVRPLVSVVKEWAKRKGINDANKSSFTSY SLVLMVIHFLQCGPTKVLPNLQQSYPNRFSNKVDVRTLNVTMALEEVADDIDQSLSEKTTLGELLIGFLDYYANEFNYDR DAISIRQGRRVERAALAVRPKIHSNSEGDKETPPPSSSASTSSIHNGGTPGIPMHHSISNPHFWRSQWRCVCIEEPFTNS NTAHSIYDEMVFEAIKKAFREAHGELQHNHDLDKLMECEPIKASTTNTGAAVFAATYEGERPLAQQPNTIACASLRVLNS IPVSSGPGHYHYQQQSNQNLSRPQRPGSNQGYQMNNNRGFNGNNQQQHQNRRSFNNQSSSNPGNGSTGPRSSRSNENVRD SSRQQNSQKGSSGVSVSKENVASTTGVPVDKKQQNSNRKDDGNRTKRSPMVQSPEPAKTKSEKTPMASSNVSQ
view sequence (1113 aa)
>GLD-2, isoform a
MVMAQQQKNAERNDEHTRRNRSPSVDSVSRVQQQSGGFAFYNQQSNHQYQQSHPRRTSFSRDGNTGYYNNHSGNKRQTYN
NQRGGRSYNHRGNSNYQQNGEYSGNQGCVPKYHQRNQNYPQLQPKYSYFQPHQRPIFNSTQGYGTYSVRRSSPPSPSALS
SSTANSTSNRAPTQPPILLRHAEPASDKNHQGSDHEQNHDPKIHLYRSAGTAPGGYTQCPSPYKQPPPQPPSTPSSSDKR
IEQQQAEDWPTRFQHPPPQFRRGQDPMPASIELQHKTANQTMPVDIVQTNQQKTVSSYERAAQFRASASELPTDSVDAKH
PCFANERMQSALIGISPQLKTQQQSPGIPIQNEAEASAVMKAMRSFQFHNWPQMSHGSYYPMPYHLENQMRPMKSGDQLP
LNQQNHNLSGFPAFVGKSSLVGSSLNTRNSSEADPEEMPRIMEKLDDEVTGADHDKTIDENRRRIHKSQEPRIGTEEKAL
NELPRKANRRNSSCSSISSVSESSSPSALDESTLTKILPTDNFRGGRGFASPSPPTSLLSEPLSRMDVLSEKIWDYHNKV
SQTDEMLQRKLHLRDMLYTAISPVFPLSGLYVVGSSLNGFGNNSSDMDLCLMITNKDLDQKNDAVVVLNLILSTLQYEKF
VESQKLILAKVPILRINFAAPFDDITVDLNANNSVAIRNTHLLCYYSSYDWRVRPLVSVVKEWAKRKGINDANKSSFTSY
SLVLMVIHFLQCGPTKVLPNLQQSYPNRFSNKVDVRTLNVTMALEEVADDIDQSLSEKTTLGELLIGFLDYYANEFNYDR
DAISIRQGRRVERAALAVRPKIHSNSEGDKETPPPSSSASTSSIHNGGTPGIPMHHSISNPHFWRSQWRCVCIEEPFTNS
NTAHSIYDEMVFEAIKKAFREAHGELQHNHDLDKLMECEPIKASTTNTGAAVFAATYEGERPLAQQPNTIACASLRVLNS
IPVSSGPGHYHYQQQSNQNLSRPQRPGSNQGYQMNNNRGFNGNNQQQHQNRRSFNNQSSSNPGNGSTGPRSSRSNENVRD
SSRQQNSQKGSSGVSVSKENVASTTGVPVDKKQQNSNRKDDGNRTKRSPMVQSPEPAKTKSEKTPMASSNVSQ
Estimated Isoelectric Point:
9.16640472412109
Estimated Molecular Weight:
124.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr55
Lys51
Gln87
Leu66
Gly59
Met26
Ser139
Tyr38
His37
Glu54
Arg72
Cys11
Phe32
Pro82
Val53
Asn90
Ala63
Ile41
Trp7
Asp50