Sequence:
download
CE32325sequence.fasta
>CTNS-1, isoform b MSFPVAFLLVLFLVPFTFATNNLVVRQKELEIVIGGEVSVNFQIKNHTSQSLNATRISLSQSPYISHPDAILVDNWNANV TVLGSQLVSGAILEALNCTTDGSITCPLDLEDAFARITVIRSHFLAILIQIVGWTYFFAWSISFYPQMYLNFKRKSVVGL NFDFLSLNLVGFCAYAIFNLLMYYNSHVKNEYNIVNPRSPPPVLLNDVVFAVHAFLACFITILQCLFYERDNQSVSSKCI ALMIVLISFGFCSAAATVLRKIQLLSFVTSLSYIKMAVTCCKYFPQAYFNYTRKSTVGWSIGNIMLDFTGGTLDILQMIL QAVNVNDWSAFYANPVKFGLGFVSIFFDIIFMVQHYVLYPNAEEPKKNQETSRF
view sequence (374 aa)
>CTNS-1, isoform b
MSFPVAFLLVLFLVPFTFATNNLVVRQKELEIVIGGEVSVNFQIKNHTSQSLNATRISLSQSPYISHPDAILVDNWNANV
TVLGSQLVSGAILEALNCTTDGSITCPLDLEDAFARITVIRSHFLAILIQIVGWTYFFAWSISFYPQMYLNFKRKSVVGL
NFDFLSLNLVGFCAYAIFNLLMYYNSHVKNEYNIVNPRSPPPVLLNDVVFAVHAFLACFITILQCLFYERDNQSVSSKCI
ALMIVLISFGFCSAAATVLRKIQLLSFVTSLSYIKMAVTCCKYFPQAYFNYTRKSTVGWSIGNIMLDFTGGTLDILQMIL
QAVNVNDWSAFYANPVKFGLGFVSIFFDIIFMVQHYVLYPNAEEPKKNQETSRF
Estimated Isoelectric Point:
7.53678131103516
Estimated Molecular Weight:
42.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr19
Lys13
Gln15
Leu41
Gly15
Met8
Ser31
Tyr16
His6
Glu10
Arg10
Cys9
Phe33
Pro14
Val35
Asn26
Ala26
Ile30
Trp5
Asp12