Sequence:
download
CE32143sequence.fasta
>FLH-2 MVDTMMNTNTDGVTAVPPIFPLPSTTPNRNNNNELAMLAQKQIVAGLLLQQPTIVQAAVNGTNSQKHLADIDYTNVIQTL QALGTTNLKAFSLLLDPQSQTSQLISEDTRPSASSSPSSTATAVSNSGQSNATSTSSSSTEPEYKPRNVREKVYADGYIM SFDKKSCCGTKEFWRCERKNDCNARMHSDINTREIVRKLHPHNHEKPSPEELAFYEQDFSTLHPNYCHPVKSINRSYMQR KLSRASHVSQALPIAPQQIKAEPMEVDTTNQTIQNFQQNNNLMLLASINAAATAAAAATSAGISPPVVGQKRVSTTVMPI TLKSQRTTPKEEEDSSQLMSQEEFRITYELTKKLMEMMKPKTEIGVRWQGDEGSILLFLSHDNGAEENVFFPVVVMNRDE KSLITALEGFTGKRCEGKLALCYSQRVNVLVHEALISNWTHGKLFLVNTDAPALWRLTPVDAFGEPLNHV
view sequence (470 aa)
>FLH-2
MVDTMMNTNTDGVTAVPPIFPLPSTTPNRNNNNELAMLAQKQIVAGLLLQQPTIVQAAVNGTNSQKHLADIDYTNVIQTL
QALGTTNLKAFSLLLDPQSQTSQLISEDTRPSASSSPSSTATAVSNSGQSNATSTSSSSTEPEYKPRNVREKVYADGYIM
SFDKKSCCGTKEFWRCERKNDCNARMHSDINTREIVRKLHPHNHEKPSPEELAFYEQDFSTLHPNYCHPVKSINRSYMQR
KLSRASHVSQALPIAPQQIKAEPMEVDTTNQTIQNFQQNNNLMLLASINAAATAAAAATSAGISPPVVGQKRVSTTVMPI
TLKSQRTTPKEEEDSSQLMSQEEFRITYELTKKLMEMMKPKTEIGVRWQGDEGSILLFLSHDNGAEENVFFPVVVMNRDE
KSLITALEGFTGKRCEGKLALCYSQRVNVLVHEALISNWTHGKLFLVNTDAPALWRLTPVDAFGEPLNHV
Estimated Isoelectric Point:
6.47443389892578
Estimated Molecular Weight:
52.0 kD
Amino Acid Composition:
Amino Acid Frequency
Thr40
Lys25
Gln27
Leu40
Gly18
Met15
Ser43
Tyr9
His12
Glu30
Arg20
Cys7
Phe14
Pro28
Val29
Asn33
Ala37
Ile21
Trp4
Asp18