Sequence:
download
CE32050sequence.fasta
>MTM-6, isoform b MSSTPSSVTTPLSAWWNNMSLSGIYPSISTSTPSSSSSWSSHFVFGGHHHHTNNNTANTPQSTVPPSALSSGYTEDITVA GSLLKDKINGLVDSLMGRESVHSGCGYGEDGRIAMMVDKVCLVDRLGCQENLVGTVHVTTTHIIFRAENGSKELWLATGL ISSVEKGTLTAAGCMLVIRCKHFQVITLLISRDKSCQDLYETLQRAAKPVSVNVTELLAFENREPVEDVRGWRRLDWNSE MTRQGITKSQWTESNINEGYTICDTYPNKLWFPTAASTSVLLGSCKFRSRGRLPVLTYFHQQTEAALCRCAQPLTGFSAR CVEDEKLMELVGKANTNSDNLFLVDTRPRVNAMVNKVQGKGFEDERNYSNMRFHFFDIENIHVMRASQARLLDAVTKCRD VTEYWKTLEASGWLKHVRSVVECSLFLAESISRGTSCVVHCSDGWDRTSQVVALCQLLLDPYYRTIHGFQVLIEKDWLGF GHKFDDRCGHVGALNDEAGKEVSPIFTQWLDCIWQIMQQKPRAFQFNERYLIEMHEHVYSCQFGTFIGNCDKDRRDLNLS KRTKSLWTWMDARHDDYMNPFYSPTAHVALLDLDTRAARFTVWTAMYNRFDNGLQPRERLEDLTMAAMEHVGVLESHVAQ LRTRLAELKTQQNQQITSTNTPTNMVDSGMSSATDDLKNLSLSHPLDPLSSTLPILERATSQESGVMDSSLYYPDEALTK YSLKWQPLRGADRCSNPACRGEFSSTIERRIHCHLCGMIFCRRCLKVSADERERVCDKCKTD
view sequence (782 aa)
>MTM-6, isoform b
MSSTPSSVTTPLSAWWNNMSLSGIYPSISTSTPSSSSSWSSHFVFGGHHHHTNNNTANTPQSTVPPSALSSGYTEDITVA
GSLLKDKINGLVDSLMGRESVHSGCGYGEDGRIAMMVDKVCLVDRLGCQENLVGTVHVTTTHIIFRAENGSKELWLATGL
ISSVEKGTLTAAGCMLVIRCKHFQVITLLISRDKSCQDLYETLQRAAKPVSVNVTELLAFENREPVEDVRGWRRLDWNSE
MTRQGITKSQWTESNINEGYTICDTYPNKLWFPTAASTSVLLGSCKFRSRGRLPVLTYFHQQTEAALCRCAQPLTGFSAR
CVEDEKLMELVGKANTNSDNLFLVDTRPRVNAMVNKVQGKGFEDERNYSNMRFHFFDIENIHVMRASQARLLDAVTKCRD
VTEYWKTLEASGWLKHVRSVVECSLFLAESISRGTSCVVHCSDGWDRTSQVVALCQLLLDPYYRTIHGFQVLIEKDWLGF
GHKFDDRCGHVGALNDEAGKEVSPIFTQWLDCIWQIMQQKPRAFQFNERYLIEMHEHVYSCQFGTFIGNCDKDRRDLNLS
KRTKSLWTWMDARHDDYMNPFYSPTAHVALLDLDTRAARFTVWTAMYNRFDNGLQPRERLEDLTMAAMEHVGVLESHVAQ
LRTRLAELKTQQNQQITSTNTPTNMVDSGMSSATDDLKNLSLSHPLDPLSSTLPILERATSQESGVMDSSLYYPDEALTK
YSLKWQPLRGADRCSNPACRGEFSSTIERRIHCHLCGMIFCRRCLKVSADERERVCDKCKTD
Estimated Isoelectric Point:
6.51918792724609
Estimated Molecular Weight:
88.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr60
Lys32
Gln29
Leu74
Gly44
Met22
Ser73
Tyr19
His26
Glu44
Arg52
Cys28
Phe28
Pro27
Val51
Asn35
Ala45
Ile29
Trp18
Asp46