Sequence:
download
CE31852sequence.fasta
>MEP-1 MVTADETVLATTTNTTSMSVEPTDPRSAGESSSDSEPDTIEQLKAEQREVMADAANGSEVNGNQENGKEEAASADVEVIE IDDTEESTDPSPDGSDENGDAASTSVPIEEEARKKDEGASEVTVASSEIEQDDDGDVMEITEEPNGKSEDTANGTVTEEV LDEEEPEPSVNGTTEIATEKEPEDSSMPVEQNGKGVKRPVECIELDDDDDDEIQEISTPAPAKKAKIDDVKATSVPEEDN NEQAQKRLLDKLEEYVKEQKDQPSSKSRKVLDTLLGAINAQVQKEPLSVRKLILDKVLVLPNTISFPPSQVCDLLIEHDP EMPLTKVINRMFGEERPKLSDSEKRERAQLKQHNPVPNMTKLLVDIGQDLVQEATYCDIVHAKNLPEVPKNLETYKQVAA QLKPVWETLKRKNEPYKLKMHRCDVCGFQTESKLVMSTHKENLHFTGSKFQCTMCKETDTSEQRMKDHYFETHLVIAKSE EKESKYPCAICEEDFNFKGVREQHYKQCKKDYIRIRNIMMPKQDDHLYINRWLWERPQLDPSILQQQQQAALQQAQQKKQ QQLLHQQQAAQAAAAAQLLRKQQLQQQQQQQQARLREQQQAAQFRQVAQLLQQQSAQAQRAQQNQGNVNHNTLIAAMQAS LRRGGQQGNSLAVSQLLQKQMAALKSQQGAQQLQAAVNSMRSQNSQKTPTHRSSKLVTTPSHATVGSSSAPTFVCEICDA SVQEKEKYLQHLQTTHKQMVGKVLQDMSQGAPLACSRCRDRFWTYEGLERHLVMSHGLVTADLLLKAQKKEDGGRCKTCG KNYAFNMLQHLVADHQVKLCSAEIMYSCDVCAFKCSSYQTLEAHLTSNHPKGDKKTSTPAKKDDCITLDD
view sequence (870 aa)
>MEP-1
MVTADETVLATTTNTTSMSVEPTDPRSAGESSSDSEPDTIEQLKAEQREVMADAANGSEVNGNQENGKEEAASADVEVIE
IDDTEESTDPSPDGSDENGDAASTSVPIEEEARKKDEGASEVTVASSEIEQDDDGDVMEITEEPNGKSEDTANGTVTEEV
LDEEEPEPSVNGTTEIATEKEPEDSSMPVEQNGKGVKRPVECIELDDDDDDEIQEISTPAPAKKAKIDDVKATSVPEEDN
NEQAQKRLLDKLEEYVKEQKDQPSSKSRKVLDTLLGAINAQVQKEPLSVRKLILDKVLVLPNTISFPPSQVCDLLIEHDP
EMPLTKVINRMFGEERPKLSDSEKRERAQLKQHNPVPNMTKLLVDIGQDLVQEATYCDIVHAKNLPEVPKNLETYKQVAA
QLKPVWETLKRKNEPYKLKMHRCDVCGFQTESKLVMSTHKENLHFTGSKFQCTMCKETDTSEQRMKDHYFETHLVIAKSE
EKESKYPCAICEEDFNFKGVREQHYKQCKKDYIRIRNIMMPKQDDHLYINRWLWERPQLDPSILQQQQQAALQQAQQKKQ
QQLLHQQQAAQAAAAAQLLRKQQLQQQQQQQQARLREQQQAAQFRQVAQLLQQQSAQAQRAQQNQGNVNHNTLIAAMQAS
LRRGGQQGNSLAVSQLLQKQMAALKSQQGAQQLQAAVNSMRSQNSQKTPTHRSSKLVTTPSHATVGSSSAPTFVCEICDA
SVQEKEKYLQHLQTTHKQMVGKVLQDMSQGAPLACSRCRDRFWTYEGLERHLVMSHGLVTADLLLKAQKKEDGGRCKTCG
KNYAFNMLQHLVADHQVKLCSAEIMYSCDVCAFKCSSYQTLEAHLTSNHPKGDKKTSTPAKKDDCITLDD
Estimated Isoelectric Point:
5.14965057373047
Estimated Molecular Weight:
97.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr53
Lys70
Gln90
Leu68
Gly33
Met22
Ser62
Tyr14
His22
Glu81
Arg33
Cys21
Phe13
Pro39
Val53
Asn34
Ala70
Ile29
Trp4
Asp59