Sequence:
download
CE31790sequence.fasta
>F18C5.10 MPAFSPLAATNEKNRPIDVIWSHEDDEEEQTIPVVKNQGFVAKVFNSRNTQHAKLIVLAVLALVHFYYLNDFLVKFAAVD QMAQDARYIKPSGINHRMDMASVRYTFQGFIDYKKNLWMTVGAMCASLATTASLLTIYSSPRDVFNRAAMAVIRVFDLCA FMFISFLLFARISSAVIINHTTQHSLRAASRISVNLVNDLGNSLSCTVEPRGELPICSRQIIDSIFPVQVIEYLIILCIL TGAYIGLAYLIEWCIRHFFPPTHEKLTPISAISRNLLVSSRCSSDNSVLIAA
view sequence (292 aa)
>F18C5.10
MPAFSPLAATNEKNRPIDVIWSHEDDEEEQTIPVVKNQGFVAKVFNSRNTQHAKLIVLAVLALVHFYYLNDFLVKFAAVD
QMAQDARYIKPSGINHRMDMASVRYTFQGFIDYKKNLWMTVGAMCASLATTASLLTIYSSPRDVFNRAAMAVIRVFDLCA
FMFISFLLFARISSAVIINHTTQHSLRAASRISVNLVNDLGNSLSCTVEPRGELPICSRQIIDSIFPVQVIEYLIILCIL
TGAYIGLAYLIEWCIRHFFPPTHEKLTPISAISRNLLVSSRCSSDNSVLIAA
Estimated Isoelectric Point:
8.15137481689453
Estimated Molecular Weight:
32.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr14
Lys9
Gln9
Leu28
Gly8
Met8
Ser26
Tyr9
His8
Glu10
Arg16
Cys7
Phe17
Pro12
Val23
Asn15
Ala29
Ile28
Trp3
Asp13