Sequence:
download
CE31765sequence.fasta
>KIN-1, isoform m MSSSSNKKVQVKFFKEFLDKAREDFKQRWENPAQNTACLDDFDRIKTLGTGSFGRVMLVKHKQSGNYYAMKILDKQKVVK LKQVEHTLNEKRILQAIDFPFLVNMTFSFKDNSNLYMVLEFISGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLD LIYRDLKPENLLIDSTGYLKITDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFAD QPIQIYEKIVSGKVKFPSHFSNELKDLLKNLLQVDLTKRYGNLKNGVADIKNHKWFGSTDWIAIYQKKIEAPFLPKCRGP GDASNFDDYEEEPLRISGTEKCAKEFAEF
view sequence (349 aa)
>KIN-1, isoform m
MSSSSNKKVQVKFFKEFLDKAREDFKQRWENPAQNTACLDDFDRIKTLGTGSFGRVMLVKHKQSGNYYAMKILDKQKVVK
LKQVEHTLNEKRILQAIDFPFLVNMTFSFKDNSNLYMVLEFISGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLD
LIYRDLKPENLLIDSTGYLKITDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFAD
QPIQIYEKIVSGKVKFPSHFSNELKDLLKNLLQVDLTKRYGNLKNGVADIKNHKWFGSTDWIAIYQKKIEAPFLPKCRGP
GDASNFDDYEEEPLRISGTEKCAKEFAEF
Estimated Isoelectric Point:
9.02957916259766
Estimated Molecular Weight:
40.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr13
Lys36
Gln12
Leu34
Gly21
Met7
Ser21
Tyr15
His7
Glu22
Arg15
Cys4
Phe26
Pro14
Val17
Asn16
Ala21
Ile21
Trp6
Asp21