Sequence:
download
CE31764sequence.fasta
>KIN-1, isoform l MPTRLDIVGNLQFSSSTDNGDEDQEADVTACFVLPSPSSFSKLSILDDPVEDFKEFLDKAREDFKQRWENPAQNTACLDD FDRIKTLGTGSFGRVMLVKHKQSGNYYAMKILDKQKVVKLKQVEHTLNEKRILQAIDFPFLVNMTFSFKDNSNLYMVLEF ISGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLDLIYRDLKPENLLIDSTGYLKITDFGFAKRVKGRTWTLCGTP EYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVKFPSHFSNELKDLLKNLLQVDLTKRYG NLKNGVADIKNHKWFGSTDWIAIYQKKIEAPFLPKCRGPGDASNFDDYEEEPLRISGTEKCAKEFAEF
view sequence (388 aa)
>KIN-1, isoform l
MPTRLDIVGNLQFSSSTDNGDEDQEADVTACFVLPSPSSFSKLSILDDPVEDFKEFLDKAREDFKQRWENPAQNTACLDD
FDRIKTLGTGSFGRVMLVKHKQSGNYYAMKILDKQKVVKLKQVEHTLNEKRILQAIDFPFLVNMTFSFKDNSNLYMVLEF
ISGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLDLIYRDLKPENLLIDSTGYLKITDFGFAKRVKGRTWTLCGTP
EYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVKFPSHFSNELKDLLKNLLQVDLTKRYG
NLKNGVADIKNHKWFGSTDWIAIYQKKIEAPFLPKCRGPGDASNFDDYEEEPLRISGTEKCAKEFAEF
Estimated Isoelectric Point:
6.05146026611328
Estimated Molecular Weight:
44.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr16
Lys34
Gln13
Leu39
Gly23
Met7
Ser25
Tyr15
His7
Glu25
Arg16
Cys5
Phe28
Pro18
Val19
Asn17
Ala23
Ile23
Trp6
Asp29