Sequence:
download
CE31763sequence.fasta
>KIN-1, isoform k MLSSSFFRGSMKERKNEALKNHKSKYISGGYLETVKEFLDKAREDFKQRWENPAQNTACLDDFDRIKTLGTGSFGRVMLV KHKQSGNYYAMKILDKQKVVKLKQVEHTLNEKRILQAIDFPFLVNMTFSFKDNSNLYMVLEFISGGEMFSHLRRIGRFSE PHSRFYAAQIVLAFEYLHSLDLIYRDLKPENLLIDSTGYLKITDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVD WWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVKFPSHFSNELKDLLKNLLQVDLTKRYGNLKNGVADIKNHKWFGST DWIAIYQKKITPPSFSKGESNGRLFEALYPRVDGPADTRHFVEEVQEPTEFVIAATPQLEELFVEF
view sequence (386 aa)
>KIN-1, isoform k
MLSSSFFRGSMKERKNEALKNHKSKYISGGYLETVKEFLDKAREDFKQRWENPAQNTACLDDFDRIKTLGTGSFGRVMLV
KHKQSGNYYAMKILDKQKVVKLKQVEHTLNEKRILQAIDFPFLVNMTFSFKDNSNLYMVLEFISGGEMFSHLRRIGRFSE
PHSRFYAAQIVLAFEYLHSLDLIYRDLKPENLLIDSTGYLKITDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVD
WWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVKFPSHFSNELKDLLKNLLQVDLTKRYGNLKNGVADIKNHKWFGST
DWIAIYQKKITPPSFSKGESNGRLFEALYPRVDGPADTRHFVEEVQEPTEFVIAATPQLEELFVEF
Estimated Isoelectric Point:
9.01601409912109
Estimated Molecular Weight:
44.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr17
Lys36
Gln13
Leu39
Gly24
Met8
Ser24
Tyr17
His9
Glu27
Arg18
Cys2
Phe28
Pro16
Val21
Asn17
Ala22
Ile22
Trp6
Asp20