Sequence:
download
CE31762sequence.fasta
>KIN-1, isoform j MGNAASGGSSGGGGSARRGNGGGNNGSDYNNAMVFSNGRLAAAETIKEFLDKAREDFKQRWENPAQNTACLDDFDRIKTL GTGSFGRVMLVKHKQSGNYYAMKILDKQKVVKLKQVEHTLNEKRILQAIDFPFLVNMTFSFKDNSNLYMVLEFISGGEMF SHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLDLIYRDLKPENLLIDSTGYLKITDFGFAKRVKGRTWTLCGTPEYLAPEI ILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVKFPSHFSNELKDLLKNLLQVDLTKRYGNLKNGVA DIKNHKWFGSTDWIAIYQKKITPPSFSKGESNGRLFEALYPRVDGPADTRHFVEEVQEPTEFVIAATPQLEELFVEF
view sequence (397 aa)
>KIN-1, isoform j
MGNAASGGSSGGGGSARRGNGGGNNGSDYNNAMVFSNGRLAAAETIKEFLDKAREDFKQRWENPAQNTACLDDFDRIKTL
GTGSFGRVMLVKHKQSGNYYAMKILDKQKVVKLKQVEHTLNEKRILQAIDFPFLVNMTFSFKDNSNLYMVLEFISGGEMF
SHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLDLIYRDLKPENLLIDSTGYLKITDFGFAKRVKGRTWTLCGTPEYLAPEI
ILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVKFPSHFSNELKDLLKNLLQVDLTKRYGNLKNGVA
DIKNHKWFGSTDWIAIYQKKITPPSFSKGESNGRLFEALYPRVDGPADTRHFVEEVQEPTEFVIAATPQLEELFVEF
Estimated Isoelectric Point:
8.71886444091797
Estimated Molecular Weight:
44.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr17
Lys31
Gln13
Leu37
Gly34
Met8
Ser24
Tyr16
His8
Glu25
Arg19
Cys2
Phe27
Pro16
Val21
Asn22
Ala28
Ile22
Trp6
Asp21