Sequence:
download
CE31761sequence.fasta
>KIN-1, isoform i MGSMVFIVKEFLDKAREDFKQRWENPAQNTACLDDFDRIKTLGTGSFGRVMLVKHKQSGNYYAMKILDKQKVVKLKQVEH TLNEKRILQAIDFPFLVNMTFSFKDNSNLYMVLEFISGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLDLIYRDL KPENLLIDSTGYLKITDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIY EKIVSGKVKFPSHFSNELKDLLKNLLQVDLTKRYGNLKNGVADIKNHKWFGSTDWIAIYQKKITPPSFSKGESNGRLFEA LYPRVDGPADTRHFVEEVQEPTEFVIAATPQLEELFVEF
view sequence (359 aa)
>KIN-1, isoform i
MGSMVFIVKEFLDKAREDFKQRWENPAQNTACLDDFDRIKTLGTGSFGRVMLVKHKQSGNYYAMKILDKQKVVKLKQVEH
TLNEKRILQAIDFPFLVNMTFSFKDNSNLYMVLEFISGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLDLIYRDL
KPENLLIDSTGYLKITDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIY
EKIVSGKVKFPSHFSNELKDLLKNLLQVDLTKRYGNLKNGVADIKNHKWFGSTDWIAIYQKKITPPSFSKGESNGRLFEA
LYPRVDGPADTRHFVEEVQEPTEFVIAATPQLEELFVEF
Estimated Isoelectric Point:
8.53792572021484
Estimated Molecular Weight:
41.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr16
Lys31
Gln13
Leu36
Gly22
Met8
Ser19
Tyr15
His8
Glu24
Arg16
Cys2
Phe27
Pro16
Val22
Asn15
Ala21
Ile22
Trp6
Asp20