Sequence:
download
CE31759sequence.fasta
>KIN-1, isoform g MGSMVFIVKEFLDKAREDFKQRWENPAQNTACLDDFDRIKTLGTGSFGRVMLVKHKQSGNYYAMKILDKQKVVKLKQVEH TLNEKRILQAIDFPFLVNMTFSFKDNSNLYMVLEFISGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLDLIYRDL KPENLLIDSTGYLKITDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIY EKIVSGKVKFPSHFSNELKDLLKNLLQVDLTKRYGNLKNGVADIKNHKWFGSTDWIAIYQKKIEAPFLPKCRGPGDASNF DDYEEEPLRISGTEKCAKEFAEF
view sequence (343 aa)
>KIN-1, isoform g
MGSMVFIVKEFLDKAREDFKQRWENPAQNTACLDDFDRIKTLGTGSFGRVMLVKHKQSGNYYAMKILDKQKVVKLKQVEH
TLNEKRILQAIDFPFLVNMTFSFKDNSNLYMVLEFISGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLDLIYRDL
KPENLLIDSTGYLKITDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIY
EKIVSGKVKFPSHFSNELKDLLKNLLQVDLTKRYGNLKNGVADIKNHKWFGSTDWIAIYQKKIEAPFLPKCRGPGDASNF
DDYEEEPLRISGTEKCAKEFAEF
Estimated Isoelectric Point:
8.75347137451172
Estimated Molecular Weight:
39.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr13
Lys33
Gln11
Leu34
Gly22
Met8
Ser18
Tyr15
His7
Glu22
Arg15
Cys4
Phe25
Pro14
Val17
Asn15
Ala21
Ile22
Trp6
Asp21