Sequence:
download
CE31758sequence.fasta
>KIN-1, isoform f MLSSSFFRGSMKERKNEALKNHKSKYISGGYLETVKEFLDKAREDFKQRWENPAQNTACLDDFDRIKTLGTGSFGRVMLV KHKQSGNYYAMKILDKQKVVKLKQVEHTLNEKRILQAIDFPFLVNMTFSFKDNSNLYMVLEFISGGEMFSHLRRIGRFSE PHSRFYAAQIVLAFEYLHSLDLIYRDLKPENLLIDSTGYLKITDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVD WWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVKFPSHFSNELKDLLKNLLQVDLTKRYGNLKNGVADIKNHKWFGST DWIAIYQKKIEAPFLPKCRGPGDASNFDDYEEEPLRISGTEKCAKEFAEF
view sequence (370 aa)
>KIN-1, isoform f
MLSSSFFRGSMKERKNEALKNHKSKYISGGYLETVKEFLDKAREDFKQRWENPAQNTACLDDFDRIKTLGTGSFGRVMLV
KHKQSGNYYAMKILDKQKVVKLKQVEHTLNEKRILQAIDFPFLVNMTFSFKDNSNLYMVLEFISGGEMFSHLRRIGRFSE
PHSRFYAAQIVLAFEYLHSLDLIYRDLKPENLLIDSTGYLKITDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVD
WWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVKFPSHFSNELKDLLKNLLQVDLTKRYGNLKNGVADIKNHKWFGST
DWIAIYQKKIEAPFLPKCRGPGDASNFDDYEEEPLRISGTEKCAKEFAEF
Estimated Isoelectric Point:
9.07369232177734
Estimated Molecular Weight:
42.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr14
Lys38
Gln11
Leu37
Gly24
Met8
Ser23
Tyr17
His8
Glu25
Arg17
Cys4
Phe26
Pro14
Val16
Asn17
Ala22
Ile22
Trp6
Asp21