Sequence:
download
CE31757sequence.fasta
>KIN-1, isoform e MPTRLDIVGNLQFSSSTDNGDEDQEADVTACFVLPSPSSFSKLSILDDPVEDFKEFLDKAREDFKQRWENPAQNTACLDD FDRIKTLGTGSFGRVMLVKHKQSGNYYAMKILDKQKVVKLKQVEHTLNEKRILQAIDFPFLVNMTFSFKDNSNLYMVLEF ISGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLDLIYRDLKPENLLIDSTGYLKITDFGFAKRVKGRTWTLCGTP EYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVKFPSHFSNELKDLLKNLLQVDLTKRYG NLKNGVADIKNHKWFGSTDWIAIYQKKITPPSFSKGESNGRLFEALYPRVDGPADTRHFVEEVQEPTEFVIAATPQLEEL FVEF
view sequence (404 aa)
>KIN-1, isoform e
MPTRLDIVGNLQFSSSTDNGDEDQEADVTACFVLPSPSSFSKLSILDDPVEDFKEFLDKAREDFKQRWENPAQNTACLDD
FDRIKTLGTGSFGRVMLVKHKQSGNYYAMKILDKQKVVKLKQVEHTLNEKRILQAIDFPFLVNMTFSFKDNSNLYMVLEF
ISGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLDLIYRDLKPENLLIDSTGYLKITDFGFAKRVKGRTWTLCGTP
EYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVKFPSHFSNELKDLLKNLLQVDLTKRYG
NLKNGVADIKNHKWFGSTDWIAIYQKKITPPSFSKGESNGRLFEALYPRVDGPADTRHFVEEVQEPTEFVIAATPQLEEL
FVEF
Estimated Isoelectric Point:
5.84980010986328
Estimated Molecular Weight:
46.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr19
Lys32
Gln15
Leu41
Gly23
Met7
Ser26
Tyr15
His8
Glu27
Arg17
Cys3
Phe30
Pro20
Val24
Asn17
Ala23
Ile23
Trp6
Asp28