Sequence:
download
CE31756sequence.fasta
>KIN-1, isoform d MSSSSNKKVQVKFFKEFLDKAREDFKQRWENPAQNTACLDDFDRIKTLGTGSFGRVMLVKHKQSGNYYAMKILDKQKVVK LKQVEHTLNEKRILQAIDFPFLVNMTFSFKDNSNLYMVLEFISGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLD LIYRDLKPENLLIDSTGYLKITDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFAD QPIQIYEKIVSGKVKFPSHFSNELKDLLKNLLQVDLTKRYGNLKNGVADIKNHKWFGSTDWIAIYQKKITPPSFSKGESN GRLFEALYPRVDGPADTRHFVEEVQEPTEFVIAATPQLEELFVEF
view sequence (365 aa)
>KIN-1, isoform d
MSSSSNKKVQVKFFKEFLDKAREDFKQRWENPAQNTACLDDFDRIKTLGTGSFGRVMLVKHKQSGNYYAMKILDKQKVVK
LKQVEHTLNEKRILQAIDFPFLVNMTFSFKDNSNLYMVLEFISGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLD
LIYRDLKPENLLIDSTGYLKITDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFAD
QPIQIYEKIVSGKVKFPSHFSNELKDLLKNLLQVDLTKRYGNLKNGVADIKNHKWFGSTDWIAIYQKKITPPSFSKGESN
GRLFEALYPRVDGPADTRHFVEEVQEPTEFVIAATPQLEELFVEF
Estimated Isoelectric Point:
8.95555877685547
Estimated Molecular Weight:
42.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr16
Lys34
Gln14
Leu36
Gly21
Met7
Ser22
Tyr15
His8
Glu24
Arg16
Cys2
Phe28
Pro16
Val22
Asn16
Ala21
Ile21
Trp6
Asp20