Sequence:
download
CE31755sequence.fasta
>KIN-1, isoform c MEEEEWRRRLSAAIRREDEGSLEEDEEDEGFILHPLCRTGPLQMTVKASNSTTTLTPSSTTTTSPSMPSSPSDSPSDDFS DDTNTSGVFPLTTALSFPVAPLSPRNTTSSITTGLVKKRRSSSSPEDICREKIPHILLKTSSGVVVPLASRGQRAPAITL QNPPPSAAIRTVPPPSFSTFSVRSLPFKTPNCGSKDDTDAENMEGLDDDYLRQPTTSTSAPVSPIDHRQVRRGGRGVVVE SQVPNFTAEIFWLKTQLSDHWSMKWLFQNTACLDDFDRIKTLGTGSFGRVMLVKHKQSGNYYAMKILDKQKVVKLKQVEH TLNEKRILQAIDFPFLVNMTFSFKDNSNLYMVLEFISGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLDLIYRDL KPENLLIDSTGYLKITDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIY EKIVSGKVKFPSHFSNELKDLLKNLLQVDLTKRYGNLKNGVADIKNHKWFGSTDWIAIYQKKVSSYPI
view sequence (548 aa)
>KIN-1, isoform c
MEEEEWRRRLSAAIRREDEGSLEEDEEDEGFILHPLCRTGPLQMTVKASNSTTTLTPSSTTTTSPSMPSSPSDSPSDDFS
DDTNTSGVFPLTTALSFPVAPLSPRNTTSSITTGLVKKRRSSSSPEDICREKIPHILLKTSSGVVVPLASRGQRAPAITL
QNPPPSAAIRTVPPPSFSTFSVRSLPFKTPNCGSKDDTDAENMEGLDDDYLRQPTTSTSAPVSPIDHRQVRRGGRGVVVE
SQVPNFTAEIFWLKTQLSDHWSMKWLFQNTACLDDFDRIKTLGTGSFGRVMLVKHKQSGNYYAMKILDKQKVVKLKQVEH
TLNEKRILQAIDFPFLVNMTFSFKDNSNLYMVLEFISGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLDLIYRDL
KPENLLIDSTGYLKITDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIY
EKIVSGKVKFPSHFSNELKDLLKNLLQVDLTKRYGNLKNGVADIKNHKWFGSTDWIAIYQKKVSSYPI
Estimated Isoelectric Point:
8.54337310791016
Estimated Molecular Weight:
61.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr41
Lys36
Gln17
Leu51
Gly30
Met11
Ser55
Tyr16
His11
Glu29
Arg30
Cys5
Phe28
Pro37
Val31
Asn20
Ala28
Ile30
Trp9
Asp33