Sequence:
download
CE31599sequence.fasta
>GPA-4 MGCFHSTGSEAKKRSKLIDEQLRHDHERCVGEIKLLLLGAGESGKSTIVRQMRILHETGFNKQEQMAYRPVVFSNMVQSM LAILKAMQPLNISFTDAAREEDARMFISHFLHVNNAELSEAFSLELSDLMKQLWMDEGVKKCVKRAHEYQLNDSAEYYFN ALDRISSSSYLPTQDDILRARVKSTGIVETTFMYKDLCFKMFDVGGQRSERKKWIHCFDSVTAVIFCVALSEYDLRLAED QTMNRMHESMQLFDSIVNNCWFTETSIILFLNKMDIFEERIRYTPLTVCFPEYQGGMTITETSTFIQSRFEILNKRQTPA QKEIYSHFTCATDTNNIRFVFDAVTDIIIRNNLYLCGLY
view sequence (359 aa)
>GPA-4
MGCFHSTGSEAKKRSKLIDEQLRHDHERCVGEIKLLLLGAGESGKSTIVRQMRILHETGFNKQEQMAYRPVVFSNMVQSM
LAILKAMQPLNISFTDAAREEDARMFISHFLHVNNAELSEAFSLELSDLMKQLWMDEGVKKCVKRAHEYQLNDSAEYYFN
ALDRISSSSYLPTQDDILRARVKSTGIVETTFMYKDLCFKMFDVGGQRSERKKWIHCFDSVTAVIFCVALSEYDLRLAED
QTMNRMHESMQLFDSIVNNCWFTETSIILFLNKMDIFEERIRYTPLTVCFPEYQGGMTITETSTFIQSRFEILNKRQTPA
QKEIYSHFTCATDTNNIRFVFDAVTDIIIRNNLYLCGLY
Estimated Isoelectric Point:
5.96910858154297
Estimated Molecular Weight:
41.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr23
Lys19
Gln16
Leu32
Gly14
Met16
Ser27
Tyr12
His10
Glu27
Arg22
Cys10
Phe23
Pro6
Val18
Asn16
Ala20
Ile25
Trp3
Asp20