Sequence:
download
CE31571sequence.fasta
>ABL-1, isoform b MGHSHSTGKEINDNELFTCEDPVFDQPVASPKSEISSKLAEEIERSKSPLILEMFRPTFDTFRPPNSDSSTFRGSQSRED LVACSSMNSVNNVHDMNTVSSSSSSSAPLFVALYDFHGVGEEQLSLRKGDQVRILGYNKNNEWCEARLYSTRKNDASNQR RLGEIGWVPSNFIAPYNSLDKYTWYHGKISRSDSEAILGSGITGSFLVRESETSIGQYTISVRHDGRVFHYRINVDNTEK MFITQEVKFRTLGELVHHHSVHADGLICLLMYPASKKDKGRGLFSLSPNAPDEWELDRSEIIMHNKLGGGQYGDVYEGYW KRHDCTIAVKALKEDAMPLHEFLAEAAIMKDLHHKNLVRLLGVCTHEAPFYIITEFMCNGNLLEYLRRTDKSLLPPIILV QMASQIASGMSYLEARHFIHRDLAARNCLVSEHNIVKIADFGLARFMKEDTYTAHAGAKFPIKWTAPEGLAFNTFSSKSD VWAFGVLLWEIATYGMAPYPGVELSNVYGLLENGFRMDGPQGCPPSVYRLMLQCWNWSPSDRPRFRDIHFNLENLISSNS LNDEVQKQLKKNNDKKLESDKRRSNVRERSDSKSRHSSHHDRDRDRESLHSRNSNPEIPNRSFIRTDDSVSFFNPSTTSK VTSFRAQGPPFPPPPQQNTKPKLLKSVLNSNARHASEEFERNEQDDVVPLAEKNVRKAVTRLGGTMPKGQRIDAYLDSMR RVDSWKESTDADNEGAGSSSLSRTVSNDSLDTLPLPDSMNSSTYVKMHPASGENVFLRQIRSKLKKRSETPELDHIDSDT ADETTKSEKSPFGSLNKSSIKYPIKNAPEFSENHSRVSPVPVPPSRNASVSVRPDSKAEDSSDETTKDVGMWGPKHAVTR KIEIVKNDSYPNVEGELKAKIRNLRHVPKEESNTSSQEDLPLDATDNTNDSIIVIPRDEKAKVRQLVTQKVSPLQHHRPF SLQCPNNSTSSAISHSEHADSSETSSLSGVYEERMKPELPRKRSNGDTKVVPVTWIINGEKEPNGMARTKSLRDITSKFE QLGTASTIESKIEEAVPYREHALEKKGTSKRFSMLEGSNELKHVVPPRKNRNQDESGSIDEEPVSKDMIVSLLKVIQKEF VNLFNLASSEITDEKLQQFVIMADNVQKLHSTCSVYAEQISPHSKFRFKELLSQLEIYNRQIKFSHNPRAKPVDDKLKMA FQDCFDQIMRLVDR
view sequence (1214 aa)
>ABL-1, isoform b
MGHSHSTGKEINDNELFTCEDPVFDQPVASPKSEISSKLAEEIERSKSPLILEMFRPTFDTFRPPNSDSSTFRGSQSRED
LVACSSMNSVNNVHDMNTVSSSSSSSAPLFVALYDFHGVGEEQLSLRKGDQVRILGYNKNNEWCEARLYSTRKNDASNQR
RLGEIGWVPSNFIAPYNSLDKYTWYHGKISRSDSEAILGSGITGSFLVRESETSIGQYTISVRHDGRVFHYRINVDNTEK
MFITQEVKFRTLGELVHHHSVHADGLICLLMYPASKKDKGRGLFSLSPNAPDEWELDRSEIIMHNKLGGGQYGDVYEGYW
KRHDCTIAVKALKEDAMPLHEFLAEAAIMKDLHHKNLVRLLGVCTHEAPFYIITEFMCNGNLLEYLRRTDKSLLPPIILV
QMASQIASGMSYLEARHFIHRDLAARNCLVSEHNIVKIADFGLARFMKEDTYTAHAGAKFPIKWTAPEGLAFNTFSSKSD
VWAFGVLLWEIATYGMAPYPGVELSNVYGLLENGFRMDGPQGCPPSVYRLMLQCWNWSPSDRPRFRDIHFNLENLISSNS
LNDEVQKQLKKNNDKKLESDKRRSNVRERSDSKSRHSSHHDRDRDRESLHSRNSNPEIPNRSFIRTDDSVSFFNPSTTSK
VTSFRAQGPPFPPPPQQNTKPKLLKSVLNSNARHASEEFERNEQDDVVPLAEKNVRKAVTRLGGTMPKGQRIDAYLDSMR
RVDSWKESTDADNEGAGSSSLSRTVSNDSLDTLPLPDSMNSSTYVKMHPASGENVFLRQIRSKLKKRSETPELDHIDSDT
ADETTKSEKSPFGSLNKSSIKYPIKNAPEFSENHSRVSPVPVPPSRNASVSVRPDSKAEDSSDETTKDVGMWGPKHAVTR
KIEIVKNDSYPNVEGELKAKIRNLRHVPKEESNTSSQEDLPLDATDNTNDSIIVIPRDEKAKVRQLVTQKVSPLQHHRPF
SLQCPNNSTSSAISHSEHADSSETSSLSGVYEERMKPELPRKRSNGDTKVVPVTWIINGEKEPNGMARTKSLRDITSKFE
QLGTASTIESKIEEAVPYREHALEKKGTSKRFSMLEGSNELKHVVPPRKNRNQDESGSIDEEPVSKDMIVSLLKVIQKEF
VNLFNLASSEITDEKLQQFVIMADNVQKLHSTCSVYAEQISPHSKFRFKELLSQLEIYNRQIKFSHNPRAKPVDDKLKMA
FQDCFDQIMRLVDR
Estimated Isoelectric Point:
6.91759490966797
Estimated Molecular Weight:
137.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr56
Lys84
Gln36
Leu94
Gly56
Met28
Ser142
Tyr28
His41
Glu90
Arg78
Cys13
Phe47
Pro69
Val72
Asn70
Ala62
Ile59
Trp13
Asp76