Sequence:
download
CE31464sequence.fasta
>MEC-5 MRLLILLLLTISSIYCALDTAAVIAIQTEINKHSADIEMILDHVKNLNARVSDLGRPGPPGTNGSPGFPGSKGEKGDRSE DGMSGRDGMQGIPGVKGDMGPLGPTGMKGDKGSMGFPGQKGEGGNSGIPGLKGDTGIPGKVGEPGSTGQPGSKGEKGMEG LPGTNGLPGAPGWPGSKGEDGLPGRPGSPGFPGKKGDVGNGGVPGVPGMIGERGLPGAPGAQGMMGPIGPPGQLGLPGPK GDLGSAGLPGSKGEMGKDGIPGLPGWIVNDKGYCILALGNCPPAFTQIGAYQAHVDNYRFGDYSLVKSSGIGGNEEQFAL KVHACCR
view sequence (327 aa)
>MEC-5
MRLLILLLLTISSIYCALDTAAVIAIQTEINKHSADIEMILDHVKNLNARVSDLGRPGPPGTNGSPGFPGSKGEKGDRSE
DGMSGRDGMQGIPGVKGDMGPLGPTGMKGDKGSMGFPGQKGEGGNSGIPGLKGDTGIPGKVGEPGSTGQPGSKGEKGMEG
LPGTNGLPGAPGWPGSKGEDGLPGRPGSPGFPGKKGDVGNGGVPGVPGMIGERGLPGAPGAQGMMGPIGPPGQLGLPGPK
GDLGSAGLPGSKGEMGKDGIPGLPGWIVNDKGYCILALGNCPPAFTQIGAYQAHVDNYRFGDYSLVKSSGIGGNEEQFAL
KVHACCR
Estimated Isoelectric Point:
6.89826202392578
Estimated Molecular Weight:
32.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr9
Lys21
Gln9
Leu25
Gly79
Met12
Ser19
Tyr5
His4
Glu13
Arg9
Cys5
Phe6
Pro35
Val12
Asn11
Ala16
Ile18
Trp2
Asp17