Sequence:
download
CE31430sequence.fasta
>ELT-2 MDNNYNDNVNGWAEMEPSQPMGGLRLPTQNMDPPEQNNESQLSELPRMKIDNDYASPIERQSVITSGTNNYEPKVETVTS FFHTGIDYSNFGMLDQTTMQPFYPLYSGIPVNTLGTFSGYTNSIYDKPSLYDPSIPTINIPSTYPTVAPTYECVKCSQSC GAGMKAVNGGMMCVNCSTPKTTYSPPVAYSTSLGQPPILEIPSEQPTAKIAKQSSKKSSSSNRGSNGSASRRQGLVCSNC NGTNTTLWRRNAEGDPVCNACGLYFKLHHIPRPTSMKKEGALQTRKRKSKSGDSSTPSTSRARERKFERASSSTEKAQRS SNRRAGSAKADRELSTAAVAAATATYVSHADLYPVSSAAVTLPDQTYSNYYQWNTAATAGLMMVPNDQNYVYAATNYQTG LRPADNIQVHVMPVQDDETKAAARDLEAVDGDS
view sequence (433 aa)
>ELT-2
MDNNYNDNVNGWAEMEPSQPMGGLRLPTQNMDPPEQNNESQLSELPRMKIDNDYASPIERQSVITSGTNNYEPKVETVTS
FFHTGIDYSNFGMLDQTTMQPFYPLYSGIPVNTLGTFSGYTNSIYDKPSLYDPSIPTINIPSTYPTVAPTYECVKCSQSC
GAGMKAVNGGMMCVNCSTPKTTYSPPVAYSTSLGQPPILEIPSEQPTAKIAKQSSKKSSSSNRGSNGSASRRQGLVCSNC
NGTNTTLWRRNAEGDPVCNACGLYFKLHHIPRPTSMKKEGALQTRKRKSKSGDSSTPSTSRARERKFERASSSTEKAQRS
SNRRAGSAKADRELSTAAVAAATATYVSHADLYPVSSAAVTLPDQTYSNYYQWNTAATAGLMMVPNDQNYVYAATNYQTG
LRPADNIQVHVMPVQDDETKAAARDLEAVDGDS
Estimated Isoelectric Point:
7.50131988525391
Estimated Molecular Weight:
47.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr38
Lys20
Gln20
Leu21
Gly26
Met14
Ser50
Tyr22
His5
Glu19
Arg21
Cys9
Phe7
Pro33
Val22
Asn31
Ala37
Ile14
Trp3
Asp21