Sequence:
download
CE31151sequence.fasta
>LIP-1, isoform a MTTHLPSTSQNGEEISAEQFNRIFHERNVIVLDCRSNGDSVKRANRFFCSLRLPALLQRRLMGGSMRLSTVPDLKDLNNS PDQCPEVLLIPGDSEQDEQLSAALARNLKSNHYRHFVLGEPVKTLLSQFPTLRDAADENWNTTFQMNSMPGQASGQQASS GPLLNLNQLRLEGEDQGGKQRAEFPVKLTNFLYLGNAETAKNRDVLKKYSISHVINVTSNLPNTFEEDPNMRYLRISADD NASHNLTKFFPEAISFIDDARRNDSACLVHCLAGISRSVTICLAYLMKTEMCTLDSAYEWVQKRNASIAPNFHFMGQLTD YEKMLGLNSNRVGVSRQAVNFDVHFFCIFKLKKKEENSPESRILAETAV
view sequence (369 aa)
>LIP-1, isoform a
MTTHLPSTSQNGEEISAEQFNRIFHERNVIVLDCRSNGDSVKRANRFFCSLRLPALLQRRLMGGSMRLSTVPDLKDLNNS
PDQCPEVLLIPGDSEQDEQLSAALARNLKSNHYRHFVLGEPVKTLLSQFPTLRDAADENWNTTFQMNSMPGQASGQQASS
GPLLNLNQLRLEGEDQGGKQRAEFPVKLTNFLYLGNAETAKNRDVLKKYSISHVINVTSNLPNTFEEDPNMRYLRISADD
NASHNLTKFFPEAISFIDDARRNDSACLVHCLAGISRSVTICLAYLMKTEMCTLDSAYEWVQKRNASIAPNFHFMGQLTD
YEKMLGLNSNRVGVSRQAVNFDVHFFCIFKLKKKEENSPESRILAETAV
Estimated Isoelectric Point:
6.51876068115234
Estimated Molecular Weight:
41.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr18
Lys17
Gln17
Leu41
Gly17
Met10
Ser32
Tyr7
His9
Glu23
Arg24
Cys8
Phe19
Pro16
Val19
Asn30
Ala26
Ile14
Trp2
Asp20