Sequence:
download
CE31080sequence.fasta
>MEC-6 MGLQSAAAHFINRFIIWITIFMVACFLLRLLVVLDLNKRVYNHTPGPCRVLTDNYKGTAGMTYVESQKRVYITLGYGRAH DLKTKTGIAFYKTNRTDGRSQQEMYDLIEMTINWNGYEYKKEFIPTGIDSYSSSNGRVLLYVINAHPNHQCIHFFQIVES SKLNHRKAICDPSFSSLQDIAVVGPDRLFVTNMAAFGRGWAQILEFSLQTGQGAVYYYDGSKLSTAASSLIAPTGIGYDA KRRILYVGSMIRESIFAYKVAKDTTLELLYEMMLLTSPIGVFVESKTGDIWIAAHPVIHESAWHYTHPENQNIHSPSQIL RIRIQEEGNSWVTTEPYANDGATISASSSVVFTDEQMLIGSSFGRLLHCDLTHSYIT
view sequence (377 aa)
>MEC-6
MGLQSAAAHFINRFIIWITIFMVACFLLRLLVVLDLNKRVYNHTPGPCRVLTDNYKGTAGMTYVESQKRVYITLGYGRAH
DLKTKTGIAFYKTNRTDGRSQQEMYDLIEMTINWNGYEYKKEFIPTGIDSYSSSNGRVLLYVINAHPNHQCIHFFQIVES
SKLNHRKAICDPSFSSLQDIAVVGPDRLFVTNMAAFGRGWAQILEFSLQTGQGAVYYYDGSKLSTAASSLIAPTGIGYDA
KRRILYVGSMIRESIFAYKVAKDTTLELLYEMMLLTSPIGVFVESKTGDIWIAAHPVIHESAWHYTHPENQNIHSPSQIL
RIRIQEEGNSWVTTEPYANDGATISASSSVVFTDEQMLIGSSFGRLLHCDLTHSYIT
Estimated Isoelectric Point:
7.23386383056641
Estimated Molecular Weight:
42.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr27
Lys15
Gln14
Leu31
Gly26
Met10
Ser32
Tyr21
His14
Glu17
Arg18
Cys5
Phe16
Pro12
Val22
Asn16
Ala26
Ile33
Trp6
Asp16