Sequence:
download
CE31071sequence.fasta
>BBS-8 MSGESVIEFTGFIKACRLFRENRLAEAEAVCTNLLRKNPLDQATWALKMQCLSDSTYVDELENEDMGLAETFLDQNVIAP NARPGTSFARPKTSAKGVNPILRPTTNAGRPLSGVVRPQSSFKSGSMDQAVRTARTAKTARAVSSTSARNMRLGTASMAA GADGEFVNLARLNIDKYAADPQVNRQLFEYVFYYLNDIRVAHQIAGTASKAAGFEDYYWKNQLAKCYLRLGMLQDATKQL QSSLEQKKLIETFALLSKAYNRVDQPMAALKTYSAGLEVFPENVTMLTGMARVQEALGEYDESVKLYKRVLDAESNNIEA IACVATTYYYGGKPELAMRYYRRILQMGVSSPELFLNIGLCCMAAQQFDFALSSILRAQSTMTDDVAADVWYNIGQILVD IGDLVSAARSFRIALSHDPDHSESLVNLGILKHREGKIDEARSLYSSATSKNPYMFEGNYNLGLVSFTQGKYHECRELIE KALAAFPEHEHCKKILNHLKPLYESI
view sequence (506 aa)
>BBS-8
MSGESVIEFTGFIKACRLFRENRLAEAEAVCTNLLRKNPLDQATWALKMQCLSDSTYVDELENEDMGLAETFLDQNVIAP
NARPGTSFARPKTSAKGVNPILRPTTNAGRPLSGVVRPQSSFKSGSMDQAVRTARTAKTARAVSSTSARNMRLGTASMAA
GADGEFVNLARLNIDKYAADPQVNRQLFEYVFYYLNDIRVAHQIAGTASKAAGFEDYYWKNQLAKCYLRLGMLQDATKQL
QSSLEQKKLIETFALLSKAYNRVDQPMAALKTYSAGLEVFPENVTMLTGMARVQEALGEYDESVKLYKRVLDAESNNIEA
IACVATTYYYGGKPELAMRYYRRILQMGVSSPELFLNIGLCCMAAQQFDFALSSILRAQSTMTDDVAADVWYNIGQILVD
IGDLVSAARSFRIALSHDPDHSESLVNLGILKHREGKIDEARSLYSSATSKNPYMFEGNYNLGLVSFTQGKYHECRELIE
KALAAFPEHEHCKKILNHLKPLYESI
Estimated Isoelectric Point:
7.06990814208984
Estimated Molecular Weight:
56.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr26
Lys27
Gln21
Leu53
Gly28
Met15
Ser38
Tyr23
His8
Glu33
Arg30
Cys9
Phe19
Pro17
Val27
Asn25
Ala58
Ile22
Trp3
Asp24