Sequence:
download
CE31068sequence.fasta
>CFI-1 MSVRIDEPQLFVSMSKEPTQETVNVGGHHDDSSSNCDERVDDQTEEQKSPPASPDLTANLNVFDLESRQKVVQRLLNSQL NLSNLRAPLNLPPIFQALQGPFSIQQQLLGLASGLTAISPGLDDYDEENTNQGEPEDLTLGGFRKETSVKSEEPSESGIN ASGPAWSYEEQFKQLYELSDDVKRKEWLDDWLNFMHRIGKPVTRIPIMAKQVLDLYELYRLVVQHGGLVEIINKKLWREI TKGLNLPSSITSAAFTLRTQYQKYLYDYECEKEKLSNQSDLQQAIDGNRREAPGRRTAPSFPLPFQLPHAASAAATMLNN QLNGLGMRNDLLDDENTLSLQASGLFGTSYGAEQMAILEAHQRNLERAQRAVQQQVARQSLGLTACSNGNGGNIHNSGRE STSSNDSDIPAKRPKLENDVKTNGASSMRISTKHSDNSKTSMSVSMEINGITYQGVLFALDETVSES
view sequence (467 aa)
>CFI-1
MSVRIDEPQLFVSMSKEPTQETVNVGGHHDDSSSNCDERVDDQTEEQKSPPASPDLTANLNVFDLESRQKVVQRLLNSQL
NLSNLRAPLNLPPIFQALQGPFSIQQQLLGLASGLTAISPGLDDYDEENTNQGEPEDLTLGGFRKETSVKSEEPSESGIN
ASGPAWSYEEQFKQLYELSDDVKRKEWLDDWLNFMHRIGKPVTRIPIMAKQVLDLYELYRLVVQHGGLVEIINKKLWREI
TKGLNLPSSITSAAFTLRTQYQKYLYDYECEKEKLSNQSDLQQAIDGNRREAPGRRTAPSFPLPFQLPHAASAAATMLNN
QLNGLGMRNDLLDDENTLSLQASGLFGTSYGAEQMAILEAHQRNLERAQRAVQQQVARQSLGLTACSNGNGGNIHNSGRE
STSSNDSDIPAKRPKLENDVKTNGASSMRISTKHSDNSKTSMSVSMEINGITYQGVLFALDETVSES
Estimated Isoelectric Point:
4.98996734619141
Estimated Molecular Weight:
51.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr24
Lys21
Gln33
Leu52
Gly30
Met10
Ser48
Tyr11
His8
Glu35
Arg24
Cys3
Phe12
Pro23
Val21
Asn31
Ala30
Ile19
Trp4
Asp28