Sequence:
download
CE30960sequence.fasta
>CGT-2 MGDKITGLEVEIIPEISEVQPESLQEQNASSLYYPLFSQYIPLLLTGTKKILEDIDYCTCFAVFGVVFVSALYFLHIVGL CYGKYRLHRPTKPNPSLPGVSIIKPIIGADANLYTNLETFFTTQYHKFELLFCFDRSDDPAVKVVESLVKKYPSVDSTMF FGGEKIGLNPKINNMMPAYRIAKYQLIMISDSGIFMKSDAVLDMASTMMSHETMALVTQTPYCKDRKGFASVFEQIYFGT SHARIYLAGNCLQFNCPTGMSSMMKKEALDECGGFAAFSGYLAEDYFFGKKLASRGYKSGISTHPALQNSAAVTMTSFTD RVCRWVKLRMAMMPQIIFVEPLQDCFPSALIISFSLNYIANIDMLTTIMLHVVFWITMDCMVMCKMQNKKMSFSPLKFLL IWLLRELFAPLVFIKAALDPSIRWRDNVFHLAWGGKIRSQTSI
view sequence (443 aa)
>CGT-2
MGDKITGLEVEIIPEISEVQPESLQEQNASSLYYPLFSQYIPLLLTGTKKILEDIDYCTCFAVFGVVFVSALYFLHIVGL
CYGKYRLHRPTKPNPSLPGVSIIKPIIGADANLYTNLETFFTTQYHKFELLFCFDRSDDPAVKVVESLVKKYPSVDSTMF
FGGEKIGLNPKINNMMPAYRIAKYQLIMISDSGIFMKSDAVLDMASTMMSHETMALVTQTPYCKDRKGFASVFEQIYFGT
SHARIYLAGNCLQFNCPTGMSSMMKKEALDECGGFAAFSGYLAEDYFFGKKLASRGYKSGISTHPALQNSAAVTMTSFTD
RVCRWVKLRMAMMPQIIFVEPLQDCFPSALIISFSLNYIANIDMLTTIMLHVVFWITMDCMVMCKMQNKKMSFSPLKFLL
IWLLRELFAPLVFIKAALDPSIRWRDNVFHLAWGGKIRSQTSI
Estimated Isoelectric Point:
8.32740020751953
Estimated Molecular Weight:
50.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr24
Lys28
Gln14
Leu43
Gly24
Met24
Ser35
Tyr19
His8
Glu18
Arg14
Cys12
Phe31
Pro22
Val25
Asn14
Ala29
Ile34
Trp5
Asp20