Sequence:
download
CE30891sequence.fasta
>MLS-2 MPTSVMNLPIDMTTMSSQERLEKMSQLPKIELMEEEEEEEMKPSSDNKIKFNISELLEDDRKPTTQSSPSASSEDSTNEI EQTAFNFNFDPKMNPISALLQLQQTFLNVGNQQNMISPLTMFPFFGLPTAQLMHFKNMSNPDVNIQSDNGEEKDEKSEGK DGETRDSTGGSPLESDAEDDDDIGRGSDDEANSSDPSQNRKKKTRTVFSRSQVSQLEMMFECKRYLSSQERSNLAQKLHL TETQVKIWFQNRRNKFKRQAQTDDTNISLQMHRANVFSIPATTALTSPILTIPTTSAGVNMRNMISSPMDASATAAARFL FGFGTLQAQQNLNASAQAQNM
view sequence (341 aa)
>MLS-2
MPTSVMNLPIDMTTMSSQERLEKMSQLPKIELMEEEEEEEMKPSSDNKIKFNISELLEDDRKPTTQSSPSASSEDSTNEI
EQTAFNFNFDPKMNPISALLQLQQTFLNVGNQQNMISPLTMFPFFGLPTAQLMHFKNMSNPDVNIQSDNGEEKDEKSEGK
DGETRDSTGGSPLESDAEDDDDIGRGSDDEANSSDPSQNRKKKTRTVFSRSQVSQLEMMFECKRYLSSQERSNLAQKLHL
TETQVKIWFQNRRNKFKRQAQTDDTNISLQMHRANVFSIPATTALTSPILTIPTTSAGVNMRNMISSPMDASATAAARFL
FGFGTLQAQQNLNASAQAQNM
Estimated Isoelectric Point:
4.77655792236328
Estimated Molecular Weight:
38.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr26
Lys19
Gln26
Leu25
Gly12
Met19
Ser39
Tyr1
His3
Glu27
Arg15
Cys1
Phe17
Pro18
Val8
Asn26
Ala21
Ile15
Trp1
Asp22