Sequence:
download
CE30741sequence.fasta
>AEX-1, isoform b MREEALESICAALSISFTEDPDHLESIIDRFSEIFKVKDHLNQLRKKCEKFQTFTLEIRPVGSSNCTENVYAYIIESETC RQLELKPTGTTKLEIGSDKNVSLKFGLSQKKDSTTSKKGLSRSASLLKKLKFSDKKNLDELKISIFPLDIAVRKNINLGS GKSTLLEMKLIRNDHRNMIQCLEFDDFLEMTRSFHEWQAQISESELYDGSLGDPTFSMFYSIAFFFEIPSFVLKLTEMTC FLVWDDEMKKLDERALADVSLKMTACESEVDLQHPLLSPALSYLNDCTCNTIRCILVPFSTEPFFPPVSPSRLKSINVAL KLIADICVLDVWDEFENLANPSNFLSSELKKLLESSAERYGESLKKQEFNELCRTILNLWMSLSNESQPYYIFFHQFDIN YIGAAMLKLDKYLAESIQISLKCQLDLLNLRIPTELENFTKTTMRLFVTLRNLLNMVEAFHLPECQLFHFEEWFTDISVF WTYSWREVTLQMVERTITLDEDGDSVKYGARRPLPAGLYSFLCIQKGISDDLARLEFTFPHHLVVCAASVVNIMCQNINA YARKLFSEAMRNHEEKASRLVRATNGIEQAMCFVEEGYRRFAQFQRLEEYVDVDDLSAVRSTSIRLLKSTRDTCEIQVST LLSHFVNLKTDIVLKIAKNLCADGKESNSGLKSYMRELASSERIESILECCYGLVDDVRCLLLPNCFKLSTQHFATSLEQ QIRKNIRQKQPAEYYSNIYVGFLNILIFKRLKQMYLKFQIALKYIYEFLEIEDRKDIELLSNLHLNSFSTKDLILSYYDS LCEKIDRTRFGNAPHVDVHISYVKMVDEDTISIQIKLIKMSPIEWIDVISDRVDYFVRLELFPKILFPSNKFESPTTNPM PQSTRPQWKQLFEIRVPLECFFLRGACLAISVFDHESSSGF
view sequence (921 aa)
>AEX-1, isoform b
MREEALESICAALSISFTEDPDHLESIIDRFSEIFKVKDHLNQLRKKCEKFQTFTLEIRPVGSSNCTENVYAYIIESETC
RQLELKPTGTTKLEIGSDKNVSLKFGLSQKKDSTTSKKGLSRSASLLKKLKFSDKKNLDELKISIFPLDIAVRKNINLGS
GKSTLLEMKLIRNDHRNMIQCLEFDDFLEMTRSFHEWQAQISESELYDGSLGDPTFSMFYSIAFFFEIPSFVLKLTEMTC
FLVWDDEMKKLDERALADVSLKMTACESEVDLQHPLLSPALSYLNDCTCNTIRCILVPFSTEPFFPPVSPSRLKSINVAL
KLIADICVLDVWDEFENLANPSNFLSSELKKLLESSAERYGESLKKQEFNELCRTILNLWMSLSNESQPYYIFFHQFDIN
YIGAAMLKLDKYLAESIQISLKCQLDLLNLRIPTELENFTKTTMRLFVTLRNLLNMVEAFHLPECQLFHFEEWFTDISVF
WTYSWREVTLQMVERTITLDEDGDSVKYGARRPLPAGLYSFLCIQKGISDDLARLEFTFPHHLVVCAASVVNIMCQNINA
YARKLFSEAMRNHEEKASRLVRATNGIEQAMCFVEEGYRRFAQFQRLEEYVDVDDLSAVRSTSIRLLKSTRDTCEIQVST
LLSHFVNLKTDIVLKIAKNLCADGKESNSGLKSYMRELASSERIESILECCYGLVDDVRCLLLPNCFKLSTQHFATSLEQ
QIRKNIRQKQPAEYYSNIYVGFLNILIFKRLKQMYLKFQIALKYIYEFLEIEDRKDIELLSNLHLNSFSTKDLILSYYDS
LCEKIDRTRFGNAPHVDVHISYVKMVDEDTISIQIKLIKMSPIEWIDVISDRVDYFVRLELFPKILFPSNKFESPTTNPM
PQSTRPQWKQLFEIRVPLECFFLRGACLAISVFDHESSSGF
Estimated Isoelectric Point:
5.61545562744141
Estimated Molecular Weight:
106.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr45
Lys62
Gln32
Leu116
Gly24
Met21
Ser85
Tyr28
His17
Glu75
Arg47
Cys27
Phe59
Pro31
Val44
Asn40
Ala42
Ile65
Trp9
Asp52