Sequence:
download
CE30740sequence.fasta
>AEX-1, isoform a MREEALESICAALSISFTEDPDHLESIIDRFSEIFKVKDHLNQLRKKCEKFQTFTLEIRPVGSSNCTENVYAYIIESETC RQLELKPTGTTKLEIGSDKNVSLKFGLSQKKDSTTSKKGLSRSASLLKKLKFSDKKNLDELKISIFPLDIAVRKNINLGS GKSTLLEMKLIRNDHRNMIQCLEFDDFLEMTRSFHEWQAQISESELYDGSLGDPTFSMFYSIAFFFEIPSFVLKLTEMTC FLVWDDEMKKLDERALADVSLKMTACESEVDLQHPLLSPALSYLNDCTCNTIRCILVPFSTEPFFPPVSPSRLKSINVAL KLIADICVLDVWDEFENLANPSNFLSSELKKLLESSAERYGESLKKQEFNELCRTILNLWMSLSNESQPYYIFFHQFDIN YIGAAMLKLDKYLAESIQISLKCQLDLLNLRIPTELENFTKTTMRLFVTLRNLLNMVEAFHLPECQLFHFEEWFTDISVF WTYSWREVTLQMVERTITLDEDGDSVKYGARRPLPAGLYSFLCIQKGISDDLARLEFTFPHHLVVCAASVVNIMCQNINA YARKLFSEAMRNHEEKASRLVRATNGIEQAMCFVEEGYRRFAQFQRLEEYVDVDDLSAVRSTSIRLLKSTRDTCEIQVST LLSHFVNLKTDIVLKIAKNLCADGKESNSGLKSYMRELASSERIESILECCYGLVDDVRCLLLPNCFKLSTQHFATSLEQ QIRKNIRQKQPAEYYSNIYVGFLNILIFKRLKQMYLKFQIALKYIYEFLEIEDRKDIELLSNLHLNSFSTKDLILSYYDS LCEKIDRTRFGNAPHVDVHISYVKMVDEDTISIQIKLIKMSPIEWIDVISDRVDYFVRLELFPKILFPSNKFESPTTNPM PQSTRPQWKQLFEIRVPLECFFLRGACLAISVFDHERFIDRLVGRGFISLHSVPQASEEKPTQRLQVPLLPNDFSDQNNV FYQLLKTRACRDSIAKEFIETRTRRHQRIRALQHYIRINRNRVGHMLLG
view sequence (1009 aa)
>AEX-1, isoform a
MREEALESICAALSISFTEDPDHLESIIDRFSEIFKVKDHLNQLRKKCEKFQTFTLEIRPVGSSNCTENVYAYIIESETC
RQLELKPTGTTKLEIGSDKNVSLKFGLSQKKDSTTSKKGLSRSASLLKKLKFSDKKNLDELKISIFPLDIAVRKNINLGS
GKSTLLEMKLIRNDHRNMIQCLEFDDFLEMTRSFHEWQAQISESELYDGSLGDPTFSMFYSIAFFFEIPSFVLKLTEMTC
FLVWDDEMKKLDERALADVSLKMTACESEVDLQHPLLSPALSYLNDCTCNTIRCILVPFSTEPFFPPVSPSRLKSINVAL
KLIADICVLDVWDEFENLANPSNFLSSELKKLLESSAERYGESLKKQEFNELCRTILNLWMSLSNESQPYYIFFHQFDIN
YIGAAMLKLDKYLAESIQISLKCQLDLLNLRIPTELENFTKTTMRLFVTLRNLLNMVEAFHLPECQLFHFEEWFTDISVF
WTYSWREVTLQMVERTITLDEDGDSVKYGARRPLPAGLYSFLCIQKGISDDLARLEFTFPHHLVVCAASVVNIMCQNINA
YARKLFSEAMRNHEEKASRLVRATNGIEQAMCFVEEGYRRFAQFQRLEEYVDVDDLSAVRSTSIRLLKSTRDTCEIQVST
LLSHFVNLKTDIVLKIAKNLCADGKESNSGLKSYMRELASSERIESILECCYGLVDDVRCLLLPNCFKLSTQHFATSLEQ
QIRKNIRQKQPAEYYSNIYVGFLNILIFKRLKQMYLKFQIALKYIYEFLEIEDRKDIELLSNLHLNSFSTKDLILSYYDS
LCEKIDRTRFGNAPHVDVHISYVKMVDEDTISIQIKLIKMSPIEWIDVISDRVDYFVRLELFPKILFPSNKFESPTTNPM
PQSTRPQWKQLFEIRVPLECFFLRGACLAISVFDHERFIDRLVGRGFISLHSVPQASEEKPTQRLQVPLLPNDFSDQNNV
FYQLLKTRACRDSIAKEFIETRTRRHQRIRALQHYIRINRNRVGHMLLG
Estimated Isoelectric Point:
6.23058319091797
Estimated Molecular Weight:
117.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr49
Lys65
Gln39
Leu126
Gly27
Met22
Ser87
Tyr30
His21
Glu79
Arg61
Cys28
Phe63
Pro35
Val49
Asn45
Ala46
Ile72
Trp9
Asp56