Sequence:
download
CE30530sequence.fasta
>FLP-22 MNRSMIALCVVLMVSLVSAQVFDLDGQQLAGLEQNDARLMEQQVKRSPSAKWMRFGKRSPSAKWMRFGKRSPSAKWMRFG KRSGAEAVSEQDY
view sequence (93 aa)
>FLP-22
MNRSMIALCVVLMVSLVSAQVFDLDGQQLAGLEQNDARLMEQQVKRSPSAKWMRFGKRSPSAKWMRFGKRSPSAKWMRFG
KRSGAEAVSEQDY
Estimated Isoelectric Point:
10.4224014282227
Estimated Molecular Weight:
10.6 kD
Amino Acid Composition:
Amino Acid Frequency
Lys7
Gln7
Leu7
Gly6
Met7
Ser11
Tyr1
Glu4
Arg9
Cys1
Phe4
Pro3
Val7
Asn2
Ala9
Ile1
Trp3
Asp4