Sequence:
download
CE30151sequence.fasta
>RGS-7, isoform b MTYTVRTKTKGLEALIRRAPVCGIAAQAVRRQILMNQQHEPNVLGNNKKVYQTFGSTPQLANERHKEMYSQIRRGDDSSF RSRDRFVPPRRPRMGYGSSDLSAIEEMSPIRSSTYSSSSEAHRLSSLRAQTEWKPQLTSTTTSFQPLSPMNHHDKENGPF KAPMSPVCSSTPRSQRMYRKNPKYRRQFGSSLQLSESRLEESTSQESERAVTPESWMEHNNENEHPDQMMFAKPKQGSFP RPEAFGLDNAYAKHKDIRGIIFLSMSLCGRRLTLNVQNAAYFCSAARPTSVCSYVSAVLCHRPSSQSSSSSRQYRQRPDE CYRTRLVTNCNSPSFDESFYFTFSENCVRDLLIVTVYEMDSNNAEKKRILGCMTFPVSRILKKASQVVGDPFPHYRRQDP MEDVEINNEGFFLLNKDQGRKQNFPQRKVRRQTFYEDPAFTGVSSAGSSVISNNTGGQMTMASPRLSVPNELTMGDYYRS TGSSDMRGRSTNNLLDYTSASSSTNGSAGGPEKLKLHRATLPSITTTTSENNSDDAKSLSPEQSPTDHHFLCPDDNGGVY GAGPAHSAIKKSSVRRAASFTFSPKHSSSKTNLRQLNGREEDKEKKRFLGPISRTLSYLRSKMDLALSTSSLYPSRDDVR QWEISFESLLNNKFGCALFRQFLKKEFSDENMDFWLECEEFKKMKDGKKSTTQKAIEIYSEFVAEHSPKEVNLDSDTRAA TKAAVEAGCKPDTFALAQSRVEQLMSKDSYRRFLRDRLFLDLLESYEITDKEDKPSSSKDKN
view sequence (782 aa)
>RGS-7, isoform b
MTYTVRTKTKGLEALIRRAPVCGIAAQAVRRQILMNQQHEPNVLGNNKKVYQTFGSTPQLANERHKEMYSQIRRGDDSSF
RSRDRFVPPRRPRMGYGSSDLSAIEEMSPIRSSTYSSSSEAHRLSSLRAQTEWKPQLTSTTTSFQPLSPMNHHDKENGPF
KAPMSPVCSSTPRSQRMYRKNPKYRRQFGSSLQLSESRLEESTSQESERAVTPESWMEHNNENEHPDQMMFAKPKQGSFP
RPEAFGLDNAYAKHKDIRGIIFLSMSLCGRRLTLNVQNAAYFCSAARPTSVCSYVSAVLCHRPSSQSSSSSRQYRQRPDE
CYRTRLVTNCNSPSFDESFYFTFSENCVRDLLIVTVYEMDSNNAEKKRILGCMTFPVSRILKKASQVVGDPFPHYRRQDP
MEDVEINNEGFFLLNKDQGRKQNFPQRKVRRQTFYEDPAFTGVSSAGSSVISNNTGGQMTMASPRLSVPNELTMGDYYRS
TGSSDMRGRSTNNLLDYTSASSSTNGSAGGPEKLKLHRATLPSITTTTSENNSDDAKSLSPEQSPTDHHFLCPDDNGGVY
GAGPAHSAIKKSSVRRAASFTFSPKHSSSKTNLRQLNGREEDKEKKRFLGPISRTLSYLRSKMDLALSTSSLYPSRDDVR
QWEISFESLLNNKFGCALFRQFLKKEFSDENMDFWLECEEFKKMKDGKKSTTQKAIEIYSEFVAEHSPKEVNLDSDTRAA
TKAAVEAGCKPDTFALAQSRVEQLMSKDSYRRFLRDRLFLDLLESYEITDKEDKPSSSKDKN
Estimated Isoelectric Point:
9.27556610107422
Estimated Molecular Weight:
88.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr47
Lys49
Gln34
Leu56
Gly36
Met23
Ser104
Tyr25
His16
Glu51
Arg65
Cys14
Phe37
Pro44
Val31
Asn39
Ala45
Ile21
Trp4
Asp41