Sequence:
download
CE30141sequence.fasta
>JBTS-14 MPPTSRPVPPPPKRRISESSSSSDDELTGNNSFRENQQRRFRENNEVGNISDSDNDEVFSHQESQSVGFIETDEERQREE HAQNSNLRNRRVSYGKIPVPPMSMTVEDIQEAAKHSREDPSGETVEVRRPNDPRRSSVSLDVFKSFRDPHDKRNMPAKDK TIYVEGPNGKFREMKKGKFWNRDKFDSPKKDAEKKQDEDSVIPFLLKAPGQAYRTQRVYNQIANIIQGFLAGISVMLAIF SFNLEPEVLLTGYRYMSLPIHAGFMVAFTVGLVSAIDRTGIYEVEHFTSRTRLTATVYNNGLITFIVWFVGLVSTLLCIQ LESQLAFAPTRIPSEDLVHHWRVFNVLRALTSGLGFLLLAFKPDSDTMAKELREAIYEQLELVTSDPERRRVIITAMKI
view sequence (399 aa)
>JBTS-14
MPPTSRPVPPPPKRRISESSSSSDDELTGNNSFRENQQRRFRENNEVGNISDSDNDEVFSHQESQSVGFIETDEERQREE
HAQNSNLRNRRVSYGKIPVPPMSMTVEDIQEAAKHSREDPSGETVEVRRPNDPRRSSVSLDVFKSFRDPHDKRNMPAKDK
TIYVEGPNGKFREMKKGKFWNRDKFDSPKKDAEKKQDEDSVIPFLLKAPGQAYRTQRVYNQIANIIQGFLAGISVMLAIF
SFNLEPEVLLTGYRYMSLPIHAGFMVAFTVGLVSAIDRTGIYEVEHFTSRTRLTATVYNNGLITFIVWFVGLVSTLLCIQ
LESQLAFAPTRIPSEDLVHHWRVFNVLRALTSGLGFLLLAFKPDSDTMAKELREAIYEQLELVTSDPERRRVIITAMKI
Estimated Isoelectric Point:
6.74562835693359
Estimated Molecular Weight:
45.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr21
Lys20
Gln15
Leu29
Gly19
Met10
Ser35
Tyr9
His8
Glu32
Arg34
Cys1
Phe22
Pro25
Val29
Asn20
Ala21
Ile23
Trp3
Asp23