Sequence:
download
CE30118sequence.fasta
>SBDS-1 MSKNIKTPTNQKVLTNVAVVRMKKTGKRFEIACYKNKVVNWRNKSEKDIDEVLQTHTVFSNVSKGQLSKKEELIAAFGIE DQLEICKIILDKGDLQVSEKERQAASDQSLKEVSQLIASMVVNPETKRPVPPSVIDKALQEMHFSLKPNRSSKQQALDAI PKLRETLKIERAKMKIRVAIPTKEAKSVHTKLKTLFSDVEVDDWQDGSLEMVGLIEPGSFRALDDLVRNETKGHGRLEIL SLKDVVEGELQIS
view sequence (253 aa)
>SBDS-1
MSKNIKTPTNQKVLTNVAVVRMKKTGKRFEIACYKNKVVNWRNKSEKDIDEVLQTHTVFSNVSKGQLSKKEELIAAFGIE
DQLEICKIILDKGDLQVSEKERQAASDQSLKEVSQLIASMVVNPETKRPVPPSVIDKALQEMHFSLKPNRSSKQQALDAI
PKLRETLKIERAKMKIRVAIPTKEAKSVHTKLKTLFSDVEVDDWQDGSLEMVGLIEPGSFRALDDLVRNETKGHGRLEIL
SLKDVVEGELQIS
Estimated Isoelectric Point:
9.13478851318359
Estimated Molecular Weight:
28.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr12
Lys31
Gln13
Leu24
Gly10
Met6
Ser20
Tyr1
His4
Glu22
Arg12
Cys2
Phe6
Pro9
Val23
Asn10
Ala14
Ile17
Trp2
Asp15