Sequence:
download
CE29990sequence.fasta
>KAT-1 MLSSSGHAIRRGITTSAALSNKHAFIVGAARTPIGSFRSSLSSVTAPELASVAIKAALERGAVKPSSIQEVFLGQVCQAN AGQAPARQAALGAGLDLSVAVTTVNKVCSSGLKAIILAAQQIQTGHQDFAIGGGMESMSQVPFYVQRGEIPYGGFQVIDG IVKDGLTDAYDKVHMGNCGEKTSKEMGITRKDQDEYAINSYKKSAKAWENGNIGPEVVPVNVKSKKGVTIVDKDEEFTKV NFDKFTSLRTVFQKDGTITAANASTLNDGAAAVIVASQEAVSEQSLKPLARILAYGDAATHPLDFAVAPTLMFPKILERA GVKQSDVAQWEVNEAFSCVPLAFIKKLGVDPSLVNPHGGAVSIGHPIGMSGARLITHLVHTLKSGQIGVAAICNGGGGSS GMVIQKL
view sequence (407 aa)
>KAT-1
MLSSSGHAIRRGITTSAALSNKHAFIVGAARTPIGSFRSSLSSVTAPELASVAIKAALERGAVKPSSIQEVFLGQVCQAN
AGQAPARQAALGAGLDLSVAVTTVNKVCSSGLKAIILAAQQIQTGHQDFAIGGGMESMSQVPFYVQRGEIPYGGFQVIDG
IVKDGLTDAYDKVHMGNCGEKTSKEMGITRKDQDEYAINSYKKSAKAWENGNIGPEVVPVNVKSKKGVTIVDKDEEFTKV
NFDKFTSLRTVFQKDGTITAANASTLNDGAAAVIVASQEAVSEQSLKPLARILAYGDAATHPLDFAVAPTLMFPKILERA
GVKQSDVAQWEVNEAFSCVPLAFIKKLGVDPSLVNPHGGAVSIGHPIGMSGARLITHLVHTLKSGQIGVAAICNGGGGSS
GMVIQKL
Estimated Isoelectric Point:
8.81819915771484
Estimated Molecular Weight:
42.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr21
Lys27
Gln20
Leu27
Gly42
Met8
Ser35
Tyr6
His9
Glu17
Arg12
Cys5
Phe14
Pro16
Val37
Asn14
Ala50
Ile28
Trp2
Asp17