Sequence:
download
CE29845sequence.fasta
>LEV-10, isoform a MHLIYLFLLSIFVSKADGNSRKTIFQCDQHFDESQPEGVIEFPSLPKQLALSHGVNNSKPEQQYNLQCVYTFVAGSRQRV RLEFDHFLLSGSSENCDIEYVDIYSEVESVDEDILSSALGGRYCGTVAPHVRISLRRVMKLVLHSRSTNHEDNHGFRAKY SFIPEDKFIAGEPVGGKKCSFIIDSSDRKIGTLYSPTYPGTYPHNMHCSYLMKAGRGERIRLFFTDFDIFFGGEHCPYDS VTIFDGPTPASPIIRKVCGLQQRMEVYSMGNSLLIHFNTTHPAKSDPRGFIMDYEFSTRFVNIDKLLNKQRGVTHIRGTE CDVRVESNRETFHTISSPNYPEVYPANTTCTYIIHGLQGEQNLEKVILTFDSIAVLSFDTSPATAPPSADIDDIACPSAW VGIAIGEGNMKAVMSSTDDSTFDVTLCERIPPNSPLLGPYISEGPRMVMQFGSTETRDDNISPIGFKATIEFKTDFGVTG ESLGTSNECKFRFTSSTGFFNSPRYPANYPLDTNCTYYIVGQPGKEILLHFEQFALSGNTDNNCNDYLDVYDVFVKNGKE ELRRKERYCADTFPGPSVSAFGSHEMRVVFTSGSSGTANGFKALFEIRTARKEDVPRGEAHIRRGAYRCGSVINSTSEKP NGLIISPNYPVKYNKDVHCDWQINVKEGYQVLLKMEAIDVEGEMTSNGASCQKAVIRVDGGPRSEYCGTKREFFEAYLSP SNSVRISFLTAPDKVNGLKGFNLSWTEVKNLSGKDENVCKSDSLYLCTYSKLCIDAKLRCNGLDNCGYGVQDDTDEQHCS LKEKTGDRTVVIAAVFCGITFVLICIFFLYLFKKKLERKKKSKRKNDTKHRQRQPYRQQRPMHKQHCDSSELSPPATSRF VHHDATGMMPPIQLHQIGSSSRDMYA
view sequence (906 aa)
>LEV-10, isoform a
MHLIYLFLLSIFVSKADGNSRKTIFQCDQHFDESQPEGVIEFPSLPKQLALSHGVNNSKPEQQYNLQCVYTFVAGSRQRV
RLEFDHFLLSGSSENCDIEYVDIYSEVESVDEDILSSALGGRYCGTVAPHVRISLRRVMKLVLHSRSTNHEDNHGFRAKY
SFIPEDKFIAGEPVGGKKCSFIIDSSDRKIGTLYSPTYPGTYPHNMHCSYLMKAGRGERIRLFFTDFDIFFGGEHCPYDS
VTIFDGPTPASPIIRKVCGLQQRMEVYSMGNSLLIHFNTTHPAKSDPRGFIMDYEFSTRFVNIDKLLNKQRGVTHIRGTE
CDVRVESNRETFHTISSPNYPEVYPANTTCTYIIHGLQGEQNLEKVILTFDSIAVLSFDTSPATAPPSADIDDIACPSAW
VGIAIGEGNMKAVMSSTDDSTFDVTLCERIPPNSPLLGPYISEGPRMVMQFGSTETRDDNISPIGFKATIEFKTDFGVTG
ESLGTSNECKFRFTSSTGFFNSPRYPANYPLDTNCTYYIVGQPGKEILLHFEQFALSGNTDNNCNDYLDVYDVFVKNGKE
ELRRKERYCADTFPGPSVSAFGSHEMRVVFTSGSSGTANGFKALFEIRTARKEDVPRGEAHIRRGAYRCGSVINSTSEKP
NGLIISPNYPVKYNKDVHCDWQINVKEGYQVLLKMEAIDVEGEMTSNGASCQKAVIRVDGGPRSEYCGTKREFFEAYLSP
SNSVRISFLTAPDKVNGLKGFNLSWTEVKNLSGKDENVCKSDSLYLCTYSKLCIDAKLRCNGLDNCGYGVQDDTDEQHCS
LKEKTGDRTVVIAAVFCGITFVLICIFFLYLFKKKLERKKKSKRKNDTKHRQRQPYRQQRPMHKQHCDSSELSPPATSRF
VHHDATGMMPPIQLHQIGSSSRDMYA
Estimated Isoelectric Point:
6.62749481201172
Estimated Molecular Weight:
101.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr54
Lys52
Gln28
Leu59
Gly66
Met18
Ser82
Tyr37
His27
Glu53
Arg51
Cys29
Phe52
Pro48
Val55
Asn43
Ala40
Ile54
Trp3
Asp55