Sequence:
download
CE29590sequence.fasta
>GLY-19 MVRFKFKTSLIIAIFFLFIYFSVESLFPRKQEDKNVSKQFLKSICTTASDSYLLDNMEINCSNILKGYKTNEKLDIMHLD IIEEQLFSCTNKCQTLKTLFRFNTNPMSAEEKHFPLSYGMLVYKDLPQVLFLLSSIYHPQNEYCIAVGENSAPIFQNLLR EVSTCFSNVHFMKRPPISWGSHEIIDSVYDCLEFLSHLETDWRYFQYLSGVDIPLKTNLEMVQILKHLNGTSNVEITNYQ QARLTGKNENESPLPLFKSSLSAIIPRKAANQLASSNTARKLLEFLWNTEIADEGFWGTLFGNKDQFNISGSINSKDWME YRDNQNNIFNPTDGWSYYISRDQIWDPELCKNYMKDDSCVFGIGDVPRLRTSKALVAHKFYLKSEPEAYFCLLKEHHRRT INPDLTFDASKYSELPQVELSRGLAMSQLTHQNWIL
view sequence (436 aa)
>GLY-19
MVRFKFKTSLIIAIFFLFIYFSVESLFPRKQEDKNVSKQFLKSICTTASDSYLLDNMEINCSNILKGYKTNEKLDIMHLD
IIEEQLFSCTNKCQTLKTLFRFNTNPMSAEEKHFPLSYGMLVYKDLPQVLFLLSSIYHPQNEYCIAVGENSAPIFQNLLR
EVSTCFSNVHFMKRPPISWGSHEIIDSVYDCLEFLSHLETDWRYFQYLSGVDIPLKTNLEMVQILKHLNGTSNVEITNYQ
QARLTGKNENESPLPLFKSSLSAIIPRKAANQLASSNTARKLLEFLWNTEIADEGFWGTLFGNKDQFNISGSINSKDWME
YRDNQNNIFNPTDGWSYYISRDQIWDPELCKNYMKDDSCVFGIGDVPRLRTSKALVAHKFYLKSEPEAYFCLLKEHHRRT
INPDLTFDASKYSELPQVELSRGLAMSQLTHQNWIL
Estimated Isoelectric Point:
6.15196990966797
Estimated Molecular Weight:
50.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr22
Lys29
Gln18
Leu49
Gly15
Met10
Ser40
Tyr18
His11
Glu28
Arg16
Cys10
Phe28
Pro18
Val16
Asn31
Ala17
Ile30
Trp8
Asp22