Sequence:
download
CE29477sequence.fasta
>LIT-1, isoform b MRDMIYGEMALVSHTHPAAVGSTTCYEKNQQKQQQVQQIPTQPQVAHVSSNAILAAAQPFYPPPVQDSQPDRPIGYGAFG VVWSVTDPRSGKRVALKKMPNVFQNLASCKRVFREIKMLSSFRHDNVLSLLDILQPANPSFFQELYVLTELMQSDLHKII VSPQALTPDHVKVFVYQILRGLKYLHTANILHRDIKPGNLLVNSNCILKICDFGLARTWDQRDRLNMTHEVVTQYYRAPE LLMGARRYTGAVDIWSVGCIFAELLQRKILFQAAGPIEQLQMIIDLLGTPSQEAMKYACEGAKNHVLRAGLRAPDTQRLY KIASPDDKNHEAVDLLQKLLHFDPDKRISVEEALQHRYLEEGRLRFHSCMCSCCYTKPNMPSRLFAQDLDPRHESPFDPK WEKDMSRLSMFELREKMYQFVMDRPALYGVALCINPQSAAYKNFASSSVAQASELPPSPQAW
view sequence (462 aa)
>LIT-1, isoform b
MRDMIYGEMALVSHTHPAAVGSTTCYEKNQQKQQQVQQIPTQPQVAHVSSNAILAAAQPFYPPPVQDSQPDRPIGYGAFG
VVWSVTDPRSGKRVALKKMPNVFQNLASCKRVFREIKMLSSFRHDNVLSLLDILQPANPSFFQELYVLTELMQSDLHKII
VSPQALTPDHVKVFVYQILRGLKYLHTANILHRDIKPGNLLVNSNCILKICDFGLARTWDQRDRLNMTHEVVTQYYRAPE
LLMGARRYTGAVDIWSVGCIFAELLQRKILFQAAGPIEQLQMIIDLLGTPSQEAMKYACEGAKNHVLRAGLRAPDTQRLY
KIASPDDKNHEAVDLLQKLLHFDPDKRISVEEALQHRYLEEGRLRFHSCMCSCCYTKPNMPSRLFAQDLDPRHESPFDPK
WEKDMSRLSMFELREKMYQFVMDRPALYGVALCINPQSAAYKNFASSSVAQASELPPSPQAW
Estimated Isoelectric Point:
8.63864898681641
Estimated Molecular Weight:
52.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr15
Lys24
Gln33
Leu48
Gly18
Met16
Ser31
Tyr17
His15
Glu21
Arg28
Cys11
Phe18
Pro32
Val29
Asn16
Ala38
Ile22
Trp5
Asp25