Sequence:
download
CE29476sequence.fasta
>LIT-1, isoform a MVSWGRGKDAYYLYISREQEEDDDDSLSFYSSQKDTEDEFCGCLFPDPEIPGSSSSSGCSSSSTELYDLAAAHAALISRQ QQILSQAIPIIPEHQLAAVAAHHQHHQQLHPSVQYQLVAAATHHNHHQPQAAQPHYSAVVPRSDVIQQPPHFALHHHLQN LVQQQQQQQAHHHHQQLVGEMALVSHTHPAAVGSTTCYEKNQQKQQQVQQIPTQPQVAHVSSNAILAAAQPFYPPPVQDS QPDRPIGYGAFGVVWSVTDPRSGKRVALKKMPNVFQNLASCKRVFREIKMLSSFRHDNVLSLLDILQPANPSFFQELYVL TELMQSDLHKIIVSPQALTPDHVKVFVYQILRGLKYLHTANILHRDIKPGNLLVNSNCILKICDFGLARTWDQRDRLNMT HEVVTQYYRAPELLMGARRYTGAVDIWSVGCIFAELLQRKILFQAAGPIEQLQMIIDLLGTPSQEAMKYACEGAKNHVLR AGLRAPDTQRLYKIASPDDKNHEAVDLLQKLLHFDPDKRISVEEALQHRYLEEGRLRFHSCMCSCCYTKPNMPSRLFAQD LDPRHESPFDPKWEKDMSRLSMFELREKMYQFVMDRPALYGVALCINPQSAAYKNFASSSVAQASELPPSPQAW
view sequence (634 aa)
>LIT-1, isoform a
MVSWGRGKDAYYLYISREQEEDDDDSLSFYSSQKDTEDEFCGCLFPDPEIPGSSSSSGCSSSSTELYDLAAAHAALISRQ
QQILSQAIPIIPEHQLAAVAAHHQHHQQLHPSVQYQLVAAATHHNHHQPQAAQPHYSAVVPRSDVIQQPPHFALHHHLQN
LVQQQQQQQAHHHHQQLVGEMALVSHTHPAAVGSTTCYEKNQQKQQQVQQIPTQPQVAHVSSNAILAAAQPFYPPPVQDS
QPDRPIGYGAFGVVWSVTDPRSGKRVALKKMPNVFQNLASCKRVFREIKMLSSFRHDNVLSLLDILQPANPSFFQELYVL
TELMQSDLHKIIVSPQALTPDHVKVFVYQILRGLKYLHTANILHRDIKPGNLLVNSNCILKICDFGLARTWDQRDRLNMT
HEVVTQYYRAPELLMGARRYTGAVDIWSVGCIFAELLQRKILFQAAGPIEQLQMIIDLLGTPSQEAMKYACEGAKNHVLR
AGLRAPDTQRLYKIASPDDKNHEAVDLLQKLLHFDPDKRISVEEALQHRYLEEGRLRFHSCMCSCCYTKPNMPSRLFAQD
LDPRHESPFDPKWEKDMSRLSMFELREKMYQFVMDRPALYGVALCINPQSAAYKNFASSSVAQASELPPSPQAW
Estimated Isoelectric Point:
6.65302276611328
Estimated Molecular Weight:
71.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr18
Lys26
Gln60
Leu62
Gly23
Met15
Ser51
Tyr23
His35
Glu29
Arg31
Cys14
Phe22
Pro43
Val38
Asn18
Ala57
Ile29
Trp6
Asp34