Sequence:
download
CE29404sequence.fasta
>RGS-7, isoform c MDSNNAEKKRILGCMTFPVSRILKKASQVVGDPFPHYRRQDPMEDVEINNEGFFLLNKDQGRKQNFPQRKVRRQTFYEDP AFTGVSSAGSSVISNNTGGQMTMASPRLSVPNELTMGDYYRSTGSSDMRGRSTNNLLDYTSASSSTNGSAGGPEKLKLHR ATLPSITTTTSENNSDDAKSLSPEQSPTDHHFLCPDDNGGVYGAGPAHSAIKKSSVRRAASFTFSPKHSSSKTNLRQLNG REEDKEKKRFLGPISRTLSYLRSKMDLALSTSSLYPSRDDVRQWEISFESLLNNKFGCALFRQFLKKEFSDENMDFWLEC EEFKKMKDGKKSTTQKAIEIYSEFVAEHSPKEVNLDSDTRAATKAAVEAGCKPDTFALAQSRVEQLMSKDSYRRFLRDRL FLDLLESYEITDKEDKPSSSKDKN
view sequence (424 aa)
>RGS-7, isoform c
MDSNNAEKKRILGCMTFPVSRILKKASQVVGDPFPHYRRQDPMEDVEINNEGFFLLNKDQGRKQNFPQRKVRRQTFYEDP
AFTGVSSAGSSVISNNTGGQMTMASPRLSVPNELTMGDYYRSTGSSDMRGRSTNNLLDYTSASSSTNGSAGGPEKLKLHR
ATLPSITTTTSENNSDDAKSLSPEQSPTDHHFLCPDDNGGVYGAGPAHSAIKKSSVRRAASFTFSPKHSSSKTNLRQLNG
REEDKEKKRFLGPISRTLSYLRSKMDLALSTSSLYPSRDDVRQWEISFESLLNNKFGCALFRQFLKKEFSDENMDFWLEC
EEFKKMKDGKKSTTQKAIEIYSEFVAEHSPKEVNLDSDTRAATKAAVEAGCKPDTFALAQSRVEQLMSKDSYRRFLRDRL
FLDLLESYEITDKEDKPSSSKDKN
Estimated Isoelectric Point:
8.83827972412109
Estimated Molecular Weight:
47.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr26
Lys35
Gln14
Leu34
Gly23
Met11
Ser54
Tyr11
His7
Glu28
Arg29
Cys5
Phe22
Pro20
Val15
Asn22
Ala25
Ile11
Trp2
Asp30