Sequence:
download
CE29403sequence.fasta
>RGS-7, isoform a MSDEDADEYDDQSSISSVSDDDDFSGSESESYQDTTESTGPSEATTDEMLWGRRRAPVCGIAAQAVRRQILMNQQHEPNV LGNNKKVYQTFGSTPQLANERHKEMYSQIRRGDDSSFRSRDRFVPPRRPRMGYGSSDLSAIEEMSPIRSSTYSSSSEAHR LSSLRAQTEWKPQLTSTTTSFQPLSPMNHHDKENGPFKAPMSPVCSSTPRSQRMYRKNPKYRRQFGSSLQLSESRLEEST SQESERAVTPESWMEHNNENEHPDQMMFAKPKQGSFPRPEAFGLDNAYAKHKDIRGIIFLSMSLCGRRLTLNVQNAAYFC SAARPTSVCSYVSAVLCHRPSSQSSSSSRQYRQRPDECYRTRLVTNCNSPSFDESFYFTFSENCVRDLLIVTVYEMDSNN AEKKRILGCMTFPVSRILKKASQVVGDPFPHYRRQDPMEDVEINNEGFFLLNKDQGRKQNFPQRKVRRQTFYEDPAFTGV SSAGSSVISNNTGGQMTMASPRLSVPNELTMGDYYRSTGSSDMRGRSTNNLLDYTSASSSTNGSAGGPEKLKLHRATLPS ITTTTSENNSDDAKSLSPEQSPTDHHFLCPDDNGGVYGAGPAHSAIKKSSVRRAASFTFSPKHSSSKTNLRQLNGREEDK EKKRFLGPISRTLSYLRSKMDLALSTSSLYPSRDDVRQWEISFESLLNNKFGCALFRQFLKKEFSDENMDFWLECEEFKK MKDGKKSTTQKAIEIYSEFVAEHSPKEVNLDSDTRAATKAAVEAGCKPDTFALAQSRVEQLMSKDSYRRFLRDRLFLDLL ESYEITDKEDKPSSSKDKN
view sequence (819 aa)
>RGS-7, isoform a
MSDEDADEYDDQSSISSVSDDDDFSGSESESYQDTTESTGPSEATTDEMLWGRRRAPVCGIAAQAVRRQILMNQQHEPNV
LGNNKKVYQTFGSTPQLANERHKEMYSQIRRGDDSSFRSRDRFVPPRRPRMGYGSSDLSAIEEMSPIRSSTYSSSSEAHR
LSSLRAQTEWKPQLTSTTTSFQPLSPMNHHDKENGPFKAPMSPVCSSTPRSQRMYRKNPKYRRQFGSSLQLSESRLEEST
SQESERAVTPESWMEHNNENEHPDQMMFAKPKQGSFPRPEAFGLDNAYAKHKDIRGIIFLSMSLCGRRLTLNVQNAAYFC
SAARPTSVCSYVSAVLCHRPSSQSSSSSRQYRQRPDECYRTRLVTNCNSPSFDESFYFTFSENCVRDLLIVTVYEMDSNN
AEKKRILGCMTFPVSRILKKASQVVGDPFPHYRRQDPMEDVEINNEGFFLLNKDQGRKQNFPQRKVRRQTFYEDPAFTGV
SSAGSSVISNNTGGQMTMASPRLSVPNELTMGDYYRSTGSSDMRGRSTNNLLDYTSASSSTNGSAGGPEKLKLHRATLPS
ITTTTSENNSDDAKSLSPEQSPTDHHFLCPDDNGGVYGAGPAHSAIKKSSVRRAASFTFSPKHSSSKTNLRQLNGREEDK
EKKRFLGPISRTLSYLRSKMDLALSTSSLYPSRDDVRQWEISFESLLNNKFGCALFRQFLKKEFSDENMDFWLECEEFKK
MKDGKKSTTQKAIEIYSEFVAEHSPKEVNLDSDTRAATKAAVEAGCKPDTFALAQSRVEQLMSKDSYRRFLRDRLFLDLL
ESYEITDKEDKPSSSKDKN
Estimated Isoelectric Point:
8.05129241943359
Estimated Molecular Weight:
92.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr48
Lys47
Gln36
Leu55
Gly38
Met24
Ser116
Tyr26
His16
Glu57
Arg65
Cys14
Phe38
Pro45
Val31
Asn39
Ala46
Ile21
Trp5
Asp52