Sequence:
download
CE29325sequence.fasta
>LIN-42, isoform a MDILSYLYDLAEPVPSTSRHSHHHHHSSLKDQNQGFPANIDLGAYIDKIVEQLVVNSTAQQQQKVAVAAAAAAQAAQAAV VATAQIRKVASAPPTTSTDPPLSYTQINCLENVHRLLKSQSRPESPAKQDEPFDEKKYPPQTPLTREALTLHTKRFEDEY KDTWCRRLKRLSDDVPSSPPAKRTTPIHWTSSSQNHYRTMAPAPPPPPGKNYQITYTPLDDLTDQKSTNTKSDVENVAYP ISGSKFSTPMRLSIDGLLPRGATSTGGASPTSGTNSPPVFPKTSSSSSLLMLRDSQN
view sequence (297 aa)
>LIN-42, isoform a
MDILSYLYDLAEPVPSTSRHSHHHHHSSLKDQNQGFPANIDLGAYIDKIVEQLVVNSTAQQQQKVAVAAAAAAQAAQAAV
VATAQIRKVASAPPTTSTDPPLSYTQINCLENVHRLLKSQSRPESPAKQDEPFDEKKYPPQTPLTREALTLHTKRFEDEY
KDTWCRRLKRLSDDVPSSPPAKRTTPIHWTSSSQNHYRTMAPAPPPPPGKNYQITYTPLDDLTDQKSTNTKSDVENVAYP
ISGSKFSTPMRLSIDGLLPRGATSTGGASPTSGTNSPPVFPKTSSSSSLLMLRDSQN
Estimated Isoelectric Point:
8.71897125244141
Estimated Molecular Weight:
32.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr27
Lys17
Gln18
Leu23
Gly9
Met4
Ser35
Tyr10
His10
Glu10
Arg14
Cys2
Phe5
Pro31
Val14
Asn11
Ala27
Ile10
Trp2
Asp18