Sequence:
download
CE29091sequence.fasta
>TUB-1 MTDTNSQWIEMNLQRQRKMLEDKQKQKRHQSAGSVRTTSTAMSMNSMKDYPTFDNSLPFSISDNSSVSVSMNTPLIPTQD PIAQPRMQSMPRQQPQQVQESLISIGDYPDNDINAKLSKVNLTSCVVSDDEDEDKRSYADSPWNTDVVADRIPSEVLPDY NFIKNNLAKFVEDPAVEHCLYKCSITRQKSGVDKGMFPTYFLHLEEFDTDKRQKIFLLAARKRKKSTTANYLLSTDPTNL SREGEGYCAKVRSNALGTQFTVYDSGQNPKKTTNHAAIRQELAAVIYETNVLGFKGPRKMTIVMPGIEPPTENRPAVRCP VRPIQDKHTLLERYRLNDLDSLKILSNKSPQWNDETQSYVLNFHGRVTQASVKNFQIIHQSSPEYIVMQFGRISDDEFTM DFRYPLSAVQAFGIAMTSFHGKLACE
view sequence (426 aa)
>TUB-1
MTDTNSQWIEMNLQRQRKMLEDKQKQKRHQSAGSVRTTSTAMSMNSMKDYPTFDNSLPFSISDNSSVSVSMNTPLIPTQD
PIAQPRMQSMPRQQPQQVQESLISIGDYPDNDINAKLSKVNLTSCVVSDDEDEDKRSYADSPWNTDVVADRIPSEVLPDY
NFIKNNLAKFVEDPAVEHCLYKCSITRQKSGVDKGMFPTYFLHLEEFDTDKRQKIFLLAARKRKKSTTANYLLSTDPTNL
SREGEGYCAKVRSNALGTQFTVYDSGQNPKKTTNHAAIRQELAAVIYETNVLGFKGPRKMTIVMPGIEPPTENRPAVRCP
VRPIQDKHTLLERYRLNDLDSLKILSNKSPQWNDETQSYVLNFHGRVTQASVKNFQIIHQSSPEYIVMQFGRISDDEFTM
DFRYPLSAVQAFGIAMTSFHGKLACE
Estimated Isoelectric Point:
7.60823822021484
Estimated Molecular Weight:
48.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr29
Lys28
Gln27
Leu29
Gly15
Met15
Ser39
Tyr14
His8
Glu21
Arg24
Cys6
Phe17
Pro26
Val25
Asn25
Ala23
Ile22
Trp3
Asp30