Sequence:
download
CE28995sequence.fasta
>MOD-5 MLRWHSVRRKQHQQLQAELSSGAASMLSAPESRRVSRSMSVKAPTASEYMPLSVADKPLTLTVSTSHSIDPNEPIAALGG LTPTKEGRVAALRRRSSMVRDKWATKMEFLLAVVGYAVDLGNIWRFPSVCYKHGGGAFLIPYFIMLMIGGLPMFYMELVL GQFHRSGCVSIWRKVCPLFRGIGYGICCICTFIAIFYNAIIAQAVYFAIVSLSKIWDSEVPWASCGNPWNTPRCSDDLNV TISRNGTPLTTPSEEYYLYKVLEVQKSTGFDDLGGVKTSMAVCLLAVFIMVYFALWKGPQSSGKIVWVTATAPYIILSIL LIRGLLLPGAKNGLYYYVTPDFEKLKDPAVWSAAATQIFFSLGPGFGVLLALSSYNDFNNNCYRDAVTTSIINCATSFFS GCVVFSTLGYMSLLTNKPINEVVGEHDASLIFIVYPQALATMDYSCFWSFIFFVMLITLGIDSTFAGIEAFITGFCDESR FLSKNRKWFVLVICIIYYFLSFPAISYGGQFVIPFLDEYGVSLSVLFIVTCEMIAVCWFYGVDQFSKDIRAMLGFYPGIY WRVCWTCSPVFISVIFIMTVYNSSFKPIQMASYTFPWWSVILGWFLRLLSVLAIPVFAIIYLLSGTGTLYERFRWAITPQ QRRNSATSLAADPTQIIDSSLLDPIHTLTPV
view sequence (671 aa)
>MOD-5
MLRWHSVRRKQHQQLQAELSSGAASMLSAPESRRVSRSMSVKAPTASEYMPLSVADKPLTLTVSTSHSIDPNEPIAALGG
LTPTKEGRVAALRRRSSMVRDKWATKMEFLLAVVGYAVDLGNIWRFPSVCYKHGGGAFLIPYFIMLMIGGLPMFYMELVL
GQFHRSGCVSIWRKVCPLFRGIGYGICCICTFIAIFYNAIIAQAVYFAIVSLSKIWDSEVPWASCGNPWNTPRCSDDLNV
TISRNGTPLTTPSEEYYLYKVLEVQKSTGFDDLGGVKTSMAVCLLAVFIMVYFALWKGPQSSGKIVWVTATAPYIILSIL
LIRGLLLPGAKNGLYYYVTPDFEKLKDPAVWSAAATQIFFSLGPGFGVLLALSSYNDFNNNCYRDAVTTSIINCATSFFS
GCVVFSTLGYMSLLTNKPINEVVGEHDASLIFIVYPQALATMDYSCFWSFIFFVMLITLGIDSTFAGIEAFITGFCDESR
FLSKNRKWFVLVICIIYYFLSFPAISYGGQFVIPFLDEYGVSLSVLFIVTCEMIAVCWFYGVDQFSKDIRAMLGFYPGIY
WRVCWTCSPVFISVIFIMTVYNSSFKPIQMASYTFPWWSVILGWFLRLLSVLAIPVFAIIYLLSGTGTLYERFRWAITPQ
QRRNSATSLAADPTQIIDSSLLDPIHTLTPV
Estimated Isoelectric Point:
8.56655120849609
Estimated Molecular Weight:
75.0 kD
Amino Acid Composition:
Amino Acid Frequency
Thr39
Lys22
Gln16
Leu66
Gly44
Met19
Ser63
Tyr32
His7
Glu19
Arg28
Cys19
Phe46
Pro35
Val52
Asn18
Ala49
Ile55
Trp19
Asp23